KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0499Help
Entry
MGAS10270_Spy0499 CDS       T00355                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00620  Pyruvate metabolism
sph00680  Methane metabolism
sph01100  Metabolic pathways
sph01120  Microbial metabolism in diverse environments
sph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS10270_Spy0499 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MGAS10270_Spy0499 (ppc)
Enzymes [BR:sph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MGAS10270_Spy0499 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: ABF33564
UniProt: Q1JHV9
LinkDB All DBs
Position
486590..489403
Genome map
AA seq 937 aa AA seqDB search
MVKSGMIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFTVIE
SIVVLSEKQDYIELEKVVANISNQEMEVISRYFSILPLLINISEDVDLAYEINHQNNTDT
DYLGKLALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRD
AKAGVINLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTE
YKNLAQKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAA
LYRTFSLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPA
ARMSSSVGLSTSAWSSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREV
MQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLVQQLMEEP
RTLSSAAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEV
GLVDQQRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNK
DGGYLASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKD
RIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVAD
SNTIYRKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQ
NRIMFPGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQ
YAQLAESQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNY
IQIELIKRWRNNQLDENDEKLIHTTINGIATGLRNSG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaaaagtggtatgatagaagaaactagcaaagaaggagatggtcatttgccactt
aaaaagttagagagtagtaacaatcaagctatcattgctgaagaagttgctcttttgaaa
gaaatgttggaaaatatcacacgacggatgattggagatgatgcgtttacagttatcgag
tctattgtggtgttatctgaaaaacaagattacatagaattagaaaaagttgtcgccaat
atttcaaatcaagaaatggaagtgatttccaggtatttttctattttacccttgctaatc
aatatttcagaagatgtcgatttagcctatgaaattaatcatcaaaataatacagatact
gattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagataatggtaaa
gacattttggagcaggttaatgtggttcctgttttaacagcacatccgacgcaagtgcaa
cgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaataccgtgat
gctaaggctggtgtaattaatcttgagaaatggcgtcaggagctatatcgttatattgaa
atgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaacgagataaaa
aatgtcatgcagtattacgatggttctctcattcaagcagtgaccaagttgacaacagag
tacaaaaacttagcccaaaaacacggtctagagttagacaatcccaaacccattaccatg
gggatgtggattggtggggaccgtgatgggaacccctttgtcacagctgaaaccttgtgc
ttgtcagctacggttcaaagtgaggttatcctcaattactacattgacaaattagcagcc
ctttaccgaacattttcactgtcgtcaaccttggtacaacccaactcggaagtggaacgt
ttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttatcgcagagct
tttcattatattcaatcgcgtcttaaacaaacacaaattcaactaactaatcagccagca
gctcgtatgagtagtagtgtgggactaagcacatctgcttggtcctcaccagctagttta
gaaaatcccatcttagcctatgactctcctgttgattttaaagctgatctaaaggctatt
gagcagtcgctacttgataatggcaactccgctttgattgagggggatttgcgagaagtc
atgcaagctgttgatatttttggcttcttcttagcaagcattgacatgaggcaagactcc
agtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgttgacgattat
agctctctttcagaaactgaaaaatgcgatgttctcgtacaacaattaatggaggagcca
aggaccttatcctcagcggcagttgctaaatcagacctattagaaaaagaactggctatc
tatactacggcacgagaattgaaagataagcttggagaagaggtcattaagcaacatatt
atttcacatacagaaagtgtctctgatatgtttgagttggccatcatgcttaaagaagtg
ggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaaaccattgag
gacttagataatgcccgtgacatcatggcagcctatttaagccatgacattgtcaaatct
tggattgcaacgaatcgtaattaccaagaaatcatgttaggttattctgacagtaataaa
gatggtggctacttggcatcgggttggactctttataaagctcagaatgaattaacggct
attggtgaggaacatggagtgaaaatcaccttcttccatggtcgtggaggaacagttggt
cgaggaggtggcccttcttatgatgccattacttcacaaccttttggttccatcaaagat
cggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaataaagatgtg
gcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtgactcaaatg
ataacagatcctaatgagattgatagttttcgagaaatcatggatagcattgttgctgat
agcaataccatttatcgaaaattggtttttgacaatccccatttctatgattatttcttt
gaggcaagcccgattaaggaagtttccagtctcaacattgggtcaagaccagcagcccgt
aaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttcatggtcacaa
aatcgcatcatgttcccaggttggtatggggtaggttcagcctttaaacgttatattgac
cgagcacaaggtaaccttgaacgcctccaacacatgtatcagacgtggccttttttccat
tccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatattgcctttcag
tatgcacaactagctgaaagtcaggatgttcgagatgttttttatgagattttggatgag
tggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatctgttggaggat
aatccttcccttaagcatagcttgaagtcacgcttgccgtattttaatgtgttgaactat
attcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaatgatgaaaaa
ttgatccatacaactattaatggcatagcgactggtttacgtaattcaggctaa

DBGET integrated database retrieval system