KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1581Help
Entry
MGAS10270_Spy1581 CDS       T00355                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00220  Arginine biosynthesis
sph00250  Alanine, aspartate and glutamate metabolism
sph00290  Valine, leucine and isoleucine biosynthesis
sph01100  Metabolic pathways
sph01110  Biosynthesis of secondary metabolites
sph01130  Biosynthesis of antibiotics
sph01210  2-Oxocarboxylic acid metabolism
sph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGAS10270_Spy1581
   00290 Valine, leucine and isoleucine biosynthesis
    MGAS10270_Spy1581
   00220 Arginine biosynthesis
    MGAS10270_Spy1581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sph01007]
    MGAS10270_Spy1581
Enzymes [BR:sph01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MGAS10270_Spy1581
    2.6.1.66  valine---pyruvate transaminase
     MGAS10270_Spy1581
Amino acid related enzymes [BR:sph01007]
 Aminotransferase (transaminase)
  Class I
   MGAS10270_Spy1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABF34646
UniProt: Q1JFB3
LinkDB All DBs
Position
complement(1518619..1519869)
Genome map
AA seq 416 aa AA seqDB search
MVYNMEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELI
SMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatggaatacgaggtgtatgagactatgaaaattattgaaaaatcatca
aaattagaacatgttgcctatgatattcgaggacctgttttggatgaagctaatcgcatg
attgcgagtggtgaaaaaattctgcgtttaaatactggcaatcctgctgcttttggtttt
gaagcaccagatgaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctat
tctgacagtaaagggattttttcagcgcgtaaggctatcatgcaatattgccaactcaag
ggcttcccagatgttgacattgaagatatttatttgggaaatggcgtgtcagagttgata
tccatgtcccttcaagctttgctagataatggcgatgaagttttagtaccaatgccggat
tatcctttatggacggcttgtgtgagtcttggtggaggaaaagcggtccattatctttgt
gatgaagaagctggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaatcctaataacccaacaggagctctttatcctaaggag
attttagaagacattgttgctttggcaagagaacaccagctgattatttttgccgatgaa
atctatgatcgtttggtgatggatggtaaagagcatattgctattgcaagtttggcacct
gatgttttttgtgtatctatgaatggcctttccaaatctcatcgtattgctggttttcgt
gttggatggatggtcttatcaggtcctaaagaccatgttaaaggttacattgaagggttg
aacatgcttgccaatatgcggttatgctccaatgttttagcccaacaagttgttcaaact
tccttaggaggccatcaatcagttgatgcactgttactgccaggagggcgtatttttgag
caacgtaattttatttatgaagctattaatgctatccctggcttatcggcagttaaacct
gaagcaggtctttatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgat
gaagaatttgtcttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggt
tttaactggaaagatccagatcacttccgtattgtttacctaccaagtgtagaagaatta
gaagatgtccaagaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system