KEGG   Sphingomonas sp. YZ-8: D3Y57_08000Help
Entry
D3Y57_08000       CDS       T05706                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spha  Sphingomonas sp. YZ-8
Pathway
spha00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D3Y57_08000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spha02000]
    D3Y57_08000
Enzymes [BR:spha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D3Y57_08000
Transporters [BR:spha02000]
 Other Transporters
  Pores ion channels [TC:1]
   D3Y57_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AYJ85927
LinkDB All DBs
Position
546832..547452
Genome map
AA seq 206 aa AA seqDB search
MTAPLTFYTNPMSRGQIARWMLEEVGQPYEQVVLDYGTTMKAPEYLAINPMGKVPAIKHG
DTVITEVAAICAYLADAFPDAGLAPAPADRADYYRWLFFAAGPVEAAITNKSLGVELAPG
KSMMAGYGSFDAAMDGLEAAVTGKRYIAGDRFSAADVYVGSQVGWGLAFGSIDKRPAFET
YWDGLKDRPAYLKAKKIDEALMPKQA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacctcttacgttctacacaaaccccatgtcgcgcggtcagattgcgcgttgg
atgctcgaggaggtcgggcaaccttatgaacaggtcgtgctcgattacggcacaacaatg
aaggcacctgaatatctggcgatcaacccgatgggcaaggttccggccatcaaacacggt
gacaccgtcattaccgaagtggcagcaatctgtgcctatctggcagatgcgtttcctgat
gctgggttagcgccagcccctgccgatcgtgccgattattatcgctggctattttttgct
gccgggcctgtcgaagcggctatcaccaataaatcactgggggtcgaactggctcccggc
aagtcgatgatggcgggctatggcagcttcgatgccgcaatggacggtcttgaagcggcg
gtgactggcaagcgctacatcgctggcgaccgtttcagcgctgcggatgtctatgtcggc
tcgcaggtcggctggggcctcgcattcggctcgatcgacaaacggcctgcgttcgagacg
tattgggatgggttgaaggaccggccagcctatctgaaggccaagaaaatcgacgaagcc
ctgatgccaaaacaggcatga

DBGET integrated database retrieval system