KEGG   Sphingomonas sp. YZ-8: D3Y57_15080Help
Entry
D3Y57_15080       CDS       T05706                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
spha  Sphingomonas sp. YZ-8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Imm51
Motif
Other DBs
NCBI-ProteinID: AYJ88039
LinkDB All DBs
Position
1973168..1974655
Genome map
AA seq 495 aa AA seqDB search
MATAPDLITLAHADRFFIGGDWVEASTTAHFDVVRPADETVIARIAEAGEVDADRAVAAA
RTAFDTGPWPRMSPQERAVYLQKIAIGLSARSEQLAHIWTNQMGVLHRIAQTSAAGASGF
FHYYASLADTFPFVERHQPIDGIGVGLLAREAVGVVLAIVPWNAPLMLAALKVAPALLAG
CSVVLKASPEAPLDAYVLAEVAQEAGLPAGVLNVVTADRAVSERMVRDPRVDKVSFTGSS
AAGRRIASICGERIARCTLELGGKSAAIVLNDYDAQKLAETLAQSTAMMSGQVWAALTRI
VVPRARHAEITEALGAAFAALKVGDPYDDASHLGPLAMGRQYDRVRDYVAQGQAEGATLV
CGGSRPKEFDRGFYMAPTVLGNVHNGMIVAREEIFGPVVSVIPVADEAEAIAVANDSDFG
LNGAVFTDDVDRAYRVARAMRTGTVGHNAFRADFMIGFGGFKQSGLGREGGRDGLLPYLE
SKTILLAGEPATLAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcacctgacctgattacactcgcgcacgcagaccggttttttatcgggggc
gattgggttgaggcatcgacaactgcgcatttcgatgtcgtccgaccggcagacgaaacg
gtcatcgcgcggatcgctgaagccggagaggttgatgccgatcgcgcagtcgcggcggcg
cgaactgcgttcgatactggaccatggccccgcatgtcgccgcaggagcgtgccgtctat
ctccagaaaatcgcgatcgggctttccgcgcgcagcgaacagcttgcccatatctggacg
aaccagatgggggttcttcaccgcatcgcacagaccagcgcggcgggggcgagcggcttc
ttccattattacgcatcgctcgccgacacattcccctttgtcgaacgccatcagccaatc
gacggcatcggcgtagggctgctcgcacgggaggcagtcggcgtcgtgctcgccatcgtt
ccgtggaacgcaccgttgatgctcgccgcgctaaaggttgcgccagccctgctggcaggt
tgctcggtcgttctaaaggcttcacccgaagcgccgctcgacgcttatgtgctggccgaa
gtggcacaggaagcaggattgcccgcaggcgtcctcaacgtcgtgactgcggatcgtgca
gtctcggaacggatggtccgcgacccgcgcgtggataaggtcagcttcaccgggtcgagc
gcggcgggtcggcgtatcgcatcgatttgtggcgagcggatcgcacgctgtacgctggaa
ctcggtggcaaatctgcggcgatcgtactgaacgattacgacgcccagaaactggccgaa
acgctggcgcaatcgaccgcgatgatgtcgggtcaggtctgggcggcgctcacccggatc
gtcgtgccccgcgcgcgccatgccgaaatcaccgaggctctcggggccgctttcgctgca
ctcaaagtcggcgatccctatgacgacgccagccatttgggtccgctcgcgatgggtcgc
caatatgaccgcgtgcgcgactatgttgcgcagggtcaggccgagggcgcaacgttggtg
tgcggtggttcgcggcccaaggaattcgatcgcggtttctacatggcgcccacggtgctg
ggaaatgtccacaacggcatgatcgtggcgcgtgaggagattttcggcccggtcgtgagc
gtaatccccgtcgctgacgaggcggaggcgatcgcggtcgccaatgacagcgacttcggc
ctgaacggggccgtgttcaccgatgacgtcgatcgcgcatatcgtgtcgcccgcgcaatg
cggacgggaacggtcgggcataatgctttccgtgccgatttcatgatcggctttggcggg
ttcaaacaatccggactcggtcgcgaaggcgggcgtgatggcctgctgccctatctggag
tccaagacgattctgctggcgggggagcctgcgacgctggcgctctga

DBGET integrated database retrieval system