KEGG   Sphingomonas sp. YZ-8: D3Y57_15485
Entry
D3Y57_15485       CDS       T05706                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spha  Sphingomonas sp. YZ-8
Pathway
spha00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D3Y57_15485
Enzymes [BR:spha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     D3Y57_15485
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     D3Y57_15485
    1.1.1.-  
     D3Y57_15485
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C TrkA_N 3HCDH_N ThiF Pyr_redox_3
Other DBs
NCBI-ProteinID: AYJ88049
UniProt: A0A494TES1
LinkDB
Position
2049243..2050256
AA seq 337 aa
MDMVRVHGPRHVSCDRVEIPIIGDNDVLVRVARCGLCGSDLGYIAIGGVAAPADAPFGIG
HELSGTIEAAGASVRGISVGLRVVVNPMGDDNIIGNGGPDGGFAPLLRVHNATLGGSIHA
IPDDVSFEHAALAEPLAVSLHAVRRANPSSGSNVAVFGAGPIGLGIVHFLKAAGVARIAV
IDLSAGRLKRARRLGADTLIDASQADVAAALGDAHGRAEVFGWPTVATDLFFEVSGAATV
LPSIIAMAPFHARVVMVAVHHAPVPVDWKMALGKELTLTTAMGYPDEFPAALAAIAAPGF
DADALISHRFPLDRFDEALNAARDRTDSAKVMVACDG
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggacatggtgcgagtccatggccctaggcacgtaagttgcgatcgggtcgagattccg
attatcggcgacaacgatgtgttagtgcgcgttgcgcgatgtggcctctgcggctccgat
ctcggctatattgccattggcggggttgctgccccggctgatgcacctttcggcatcgga
catgaactttccgggacgatcgaggcagccggggcttcggtgcggggtatctccgttggt
ttgcgcgtcgtcgttaatccgatgggtgacgataatattatcggtaacggtgggccagac
ggtggttttgcgccattgttgcgggtgcataacgcgacgctgggtggcagcattcatgcg
atccccgatgatgtctcgttcgaacatgcggcacttgccgaaccgctggcggtgtcgctc
catgcggtgcgccgcgcaaatccttcgtcgggcagcaacgttgccgttttcggagccggg
ccaatcgggttgggcattgtccattttttgaaagctgccggtgtcgcgcggatcgccgtg
atcgatctgtcagccgggcgactgaaaagagcgcggagactcggcgcggatacacttatc
gatgccagccaggcggatgtcgcagccgcgcttggtgacgcacatggtcgcgcggaagta
ttcggttggccgaccgtggcgacagatttgttcttcgaagtttccggtgcagcgacagtg
ctgccctctatcattgcgatggcaccgtttcatgcccgcgtcgtaatggttgcggtgcat
cacgcgcctgtccccgtcgattggaagatggcgctcggcaaagaactgacacttaccacc
gccatggggtacccggacgaatttccggctgcgctggcggcgattgcggcaccgggtttc
gatgcagatgcgctgataagccatcgttttccgctcgatcgcttcgacgaagctctcaac
gccgcgcgtgatcgaaccgactcggcaaaagttatggtggcatgtgatggctga

DBGET integrated database retrieval system