KEGG   Sphingomonas sp. YZ-8: D3Y57_15485Help
Entry
D3Y57_15485       CDS       T05706                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
spha  Sphingomonas sp. YZ-8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C TrkA_N 3HCDH_N ThiF Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AYJ88049
UniProt: A0A494TES1
LinkDB All DBs
Position
2049243..2050256
Genome map
AA seq 337 aa AA seqDB search
MDMVRVHGPRHVSCDRVEIPIIGDNDVLVRVARCGLCGSDLGYIAIGGVAAPADAPFGIG
HELSGTIEAAGASVRGISVGLRVVVNPMGDDNIIGNGGPDGGFAPLLRVHNATLGGSIHA
IPDDVSFEHAALAEPLAVSLHAVRRANPSSGSNVAVFGAGPIGLGIVHFLKAAGVARIAV
IDLSAGRLKRARRLGADTLIDASQADVAAALGDAHGRAEVFGWPTVATDLFFEVSGAATV
LPSIIAMAPFHARVVMVAVHHAPVPVDWKMALGKELTLTTAMGYPDEFPAALAAIAAPGF
DADALISHRFPLDRFDEALNAARDRTDSAKVMVACDG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacatggtgcgagtccatggccctaggcacgtaagttgcgatcgggtcgagattccg
attatcggcgacaacgatgtgttagtgcgcgttgcgcgatgtggcctctgcggctccgat
ctcggctatattgccattggcggggttgctgccccggctgatgcacctttcggcatcgga
catgaactttccgggacgatcgaggcagccggggcttcggtgcggggtatctccgttggt
ttgcgcgtcgtcgttaatccgatgggtgacgataatattatcggtaacggtgggccagac
ggtggttttgcgccattgttgcgggtgcataacgcgacgctgggtggcagcattcatgcg
atccccgatgatgtctcgttcgaacatgcggcacttgccgaaccgctggcggtgtcgctc
catgcggtgcgccgcgcaaatccttcgtcgggcagcaacgttgccgttttcggagccggg
ccaatcgggttgggcattgtccattttttgaaagctgccggtgtcgcgcggatcgccgtg
atcgatctgtcagccgggcgactgaaaagagcgcggagactcggcgcggatacacttatc
gatgccagccaggcggatgtcgcagccgcgcttggtgacgcacatggtcgcgcggaagta
ttcggttggccgaccgtggcgacagatttgttcttcgaagtttccggtgcagcgacagtg
ctgccctctatcattgcgatggcaccgtttcatgcccgcgtcgtaatggttgcggtgcat
cacgcgcctgtccccgtcgattggaagatggcgctcggcaaagaactgacacttaccacc
gccatggggtacccggacgaatttccggctgcgctggcggcgattgcggcaccgggtttc
gatgcagatgcgctgataagccatcgttttccgctcgatcgcttcgacgaagctctcaac
gccgcgcgtgatcgaaccgactcggcaaaagttatggtggcatgtgatggctga

DBGET integrated database retrieval system