KEGG   Sphingobium sp. EP60837: EP837_01588Help
Entry
EP837_01588       CDS       T04432                                 

Definition
(GenBank) Glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EP837_01588
Enzymes [BR:sphb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EP837_01588
Transporters [BR:sphb02000]
 Other Transporters
  Pores ion channels [TC:1]
   EP837_01588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ANI78004
UniProt: A0A173KWB6
LinkDB All DBs
Position
1:1619014..1619685
Genome map
AA seq 223 aa AA seqDB search
MWQLFQFPLCPFSRKIRLLLGEKGVGYDLVRESPWEARDEFLDLNPAGTTPVMVDVEKGV
TLIDSQAICEYFEETVEKFPLISGTAAGRAEVRRLVAFFDQNFYGDVVGPLLHERMKKRL
IERAPPDARVLREAMKRANVHMDYMDYLLDHRSWMAGGTMSLADIAAAAHLSVADYLGGI
DWAGHETVKRWYAGFKSRPSFRPLLSERMEVITPPPHYEKPDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctcttccaattcccgctttgtcccttctcgcgcaagattcgcctgctgctc
ggtgaaaagggggtgggttatgatctggtgcgcgagtcgccctgggaagcgcgcgacgag
tttctcgacctcaatcctgcaggcacgacgccggtgatggtggacgtcgaaaagggcgtt
acgctgatcgacagccaggcgatctgcgaatattttgaggagacggtggagaaattcccg
ctgatctccggcacggcggcgggccgggctgaggtgcggcggctggtggcctttttcgac
cagaatttctatggcgatgtcgtcggcccgttgctgcatgaacggatgaaaaagcgcctg
atcgaacgtgcgccccccgacgcccgggtgctgcgcgaggcgatgaagcgcgccaatgtg
cacatggattatatggattatctgctcgaccaccgcagctggatggcaggcgggacgatg
agcctggcggacattgccgctgccgcacatctttccgtggcggattatctcggcggcatc
gactgggcgggccatgagacggtgaagcgctggtatgcaggcttcaagtcgcgtccttcc
ttccggccgctgctgtcggagcggatggaggtgatcacgccgccgcctcattatgagaag
ccggatttttga

DBGET integrated database retrieval system