KEGG   Sphingobium sp. EP60837: EP837_02131Help
Entry
EP837_02131       CDS       T04432                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphb  Sphingobium sp. EP60837
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EP837_02131 (ahpF)
Enzymes [BR:sphb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EP837_02131 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin FAD_binding_2 DAO K_oxygenase Thi4 NAD_binding_8 FMO-like Peripla_BP_2 HTH_43 Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: ANI78535
UniProt: A0A173KZ34
LinkDB All DBs
Position
1:complement(2187226..2188809)
Genome map
AA seq 527 aa AA seqDB search
MLDANLKGQLKAYMANITQPIELVASLDEGAKSRELEGLLNEIAELSDKVSLVLAGHDKR
KPSFMIRRAGTDIAVTFAGIPMGHEFTSLVLALLQVGGHPSKAAQDVIDQIKDLDGDFTF
ETYFSLSCQNCPDVVQALNLMSVLNPRIRHVAIDGALFKEEVDARQVMAVPTVFLNGEPF
ASGRMELEQIVAKIDSDAADRAAEKIRKQNPFEVLIVGGGPAGAASAIYAARKGIRTGIA
AERFGGQVLDTMDIENFISVSRTEGPKLASALEAHVKDYDVEIMNLQKAAKLVPAKTEGG
YHEVVLENGASLKGRTVILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKDKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVRIITSAMTTKVEGDG
ARVTGLSYKDRNHGTAHDIELEGIFVQIGLVPNTEWLKDAVALSPHGEIEIDARGETSQP
GIFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYLIRLPASAETAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaaaggccagctcaaggcctatatggcgaacatcacgcagccc
atcgagctggtggcatcgctggacgagggcgcgaagtcgcgcgaactggaaggactgctg
aacgagatcgccgagctgtcggacaaggtgtcgctggtgctggcagggcatgacaagcgc
aagcccagcttcatgatccgccgcgcaggcacggacattgccgtgacattcgccggcatt
cccatgggccacgagttcacctcgctggttctggccctgctgcaggtcggtggccatccg
tccaaagcggcgcaggatgtcatcgatcagatcaaggatctggatggcgacttcaccttc
gaaacctatttctcgctttcatgccagaactgccccgatgtggtgcaggcgctgaacctg
atgagcgttctcaacccccgcatccgacacgtcgccatcgatggcgcgctgttcaaggag
gaagtcgatgcacgccaggtcatggccgtgccgaccgtcttcctgaatggcgaaccgttc
gctagcggccgcatggagctggagcagatcgtcgcgaagatcgacagcgacgcggccgac
cgcgcagcggagaagatccgtaagcaaaaccccttcgaagtcctcatcgtcggcggcggt
cctgcgggcgctgcgtcggccatatatgctgcgcgcaagggcatccgcaccggcatcgca
gcggagcggttcggcggccaggtgctcgacacgatggatatcgagaatttcatctcggtc
agccgcaccgagggtcccaagctcgcctcggcattggaggcgcatgtgaaggattatgat
gtcgagatcatgaacctgcaaaaggcggcaaagctggtcccagccaaaaccgaaggcggc
tatcatgaggtcgtgctggaaaatggcgcgagcctgaagggccgcaccgtcatcctgtcc
accggggcgcgctggcggcagatgggcgtgcccggcgaagaggaatatcgcaacaagggc
gttgcctattgcccgcactgcgacggacctttgttcaaggacaagcgagtggcggtgatc
ggcggcggcaatagcggtgtcgaagcggcaatcgaccttgccggcatcgttgctcacgtg
acgctgatcgagttcgacagccagctgcgcgccgacgcggtgctgcagcggaagctcgcg
agcttgcccaatgtgcgcatcatcacctcggccatgacgaccaaggtggagggcgacggc
gcgagggtgactggcctgtcgtacaaggatcgcaaccacggcaccgctcatgacatcgag
ctggagggcattttcgttcagatcggtctcgtccccaacaccgaatggttgaaggacgcg
gttgccctttccccgcatggcgagatcgagattgacgcgcgtggcgaaacgagccagcca
gggatattcgctgccggcgattgcacgaccgtgccctataagcagatcgtgatcgccatg
ggtgcgggttcgaccgcggcgctttctgccttcgactatctcattcgcttgcctgcttcg
gcggaaacggcagaagctgcgtaa

DBGET integrated database retrieval system