KEGG   Sphingobium sp. EP60837: EP837_02183Help
Entry
EP837_02183       CDS       T04432                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00473  D-Alanine metabolism
sphb00550  Peptidoglycan biosynthesis
sphb01100  Metabolic pathways
sphb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EP837_02183
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EP837_02183
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    EP837_02183
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphb01011]
    EP837_02183
Enzymes [BR:sphb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EP837_02183
Peptidoglycan biosynthesis and degradation proteins [BR:sphb01011]
 Precursor biosynthesis
  Amino acid ligase
   EP837_02183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ANI78587
UniProt: A0A173KXM9
LinkDB All DBs
Position
1:2237062..2238021
Genome map
AA seq 319 aa AA seqDB search
MTRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHKVTRIDMDRNVAARLADADADV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGHVV
TSASLFEADPLPRPYVVKPVNEGSSVGVAIITPDGNYGSPIGRDVEGPWQHFEELLAEPY
IRGRELTTAVLGDEALLVTELRPKSGFYDFDAKYTDGMTEHVCPAEIPNEISEACKALAL
RAHQLLGCKGASRSDFRWDDTQGVQGLYLLEVNTQPGMTPLSLVPEQAAKLGIDYAELVE
RIVEDALRQVPGAKGADNG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtggcccctggcatgttgctgtcctgatgggcggctggtccgccgagcggcct
gtttccttgtcgagcggcgagggggtcgcaaaagcgctggaatcgcgtgggcacaaggtc
acgcggatcgacatggaccgtaacgtcgccgcccgccttgccgacgctgatgctgacgtt
gtgttcaatgccttgcacggcgttcccggcgaggatggcacggtgcaggggatgatggac
ctgatgggcctcacctacactcattcgggcttggcgacatcggtcatcgctattgataag
caactgacgaagcaggcgctggtgcctcatggtatccccatgccgggcggccatgtcgta
accagcgccagcctgttcgaagctgatcccctgccgcgcccctatgtggtgaagccggtc
aacgaaggcagctccgtcggcgttgccatcataacgccggacggcaattacggctcaccg
atcggtcgcgatgtcgaaggtccatggcagcatttcgaggaactgctcgccgagccctat
attcgcggacgcgaactcaccaccgccgtactcggtgatgaagcgctgctagtgacggaa
ctgcggcccaagagcggcttctatgatttcgacgccaaatataccgacggcatgaccgaa
catgtatgcccggcggaaatccccaacgagatcagcgaggcgtgcaaggcgctcgccctg
cgcgcgcaccaactgcttggctgcaagggggcatcgcgctccgacttccgctgggatgac
acccaaggagtccaagggctttatctgcttgaggtgaatactcagccgggcatgacgccc
ttaagtctggtgcctgagcaggcggcgaaactgggcattgactatgccgaactggtcgag
cgtattgtcgaagacgcgctgaggcaggtgccgggcgcaaagggggcagacaatgggtga

DBGET integrated database retrieval system