KEGG   Sphingobium sp. EP60837: EP837_02295Help
Entry
EP837_02295       CDS       T04432                                 

Definition
(GenBank) Glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EP837_02295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphb02000]
    EP837_02295
Enzymes [BR:sphb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EP837_02295
Transporters [BR:sphb02000]
 Other Transporters
  Pores ion channels [TC:1]
   EP837_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ANI78696
UniProt: A0A173KXF0
LinkDB All DBs
Position
1:complement(2341954..2342586)
Genome map
AA seq 210 aa AA seqDB search
MPADITFYTNPMSRGQIARWMLEEVGQPYETVVLDYGDDGMKSADYMAINPMGKVPAIVH
AGKVVTEAAAICAYLADAFPAAGLAPPTDSRSDYYRWLFFAAGPVEAAITNKALGFVMPE
GRDRMAGYGTFDHAIDTLEHAVSVPAWICGNQFTAADVYVGAQVDWGLTFGTLPTRPAFE
GYASRLRERPAYKRQKELDGALIAQMKKPA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagatatcaccttctacacaaaccccatgtcgcgcggacagatcgctcgttgg
atgctggaggaagtcggacagccctatgagacggtggtactggattatggcgacgacggc
atgaagtccgccgactatatggcgattaatccaatgggcaaagtgcctgccatcgttcat
gcgggcaaggtcgtgaccgaagctgccgccatctgcgcctatctcgccgatgccttcccc
gccgctgggctggcgccgccgaccgacagccgctccgactattatcgctggctgttcttc
gccgccggacccgtcgaggccgccatcaccaacaaggcgctcggcttcgtcatgccggaa
ggtcgcgatcggatggcgggctatggaacattcgaccatgccatcgatacgctggagcat
gcggtctcagtgccagcctggatatgcggcaatcagttcaccgccgcggacgtctatgtg
ggagcgcaggtggattggggcctgacctttggcactctgcccacccggcccgccttcgaa
ggctatgcaagccgccttcgggagcggcccgcttataagcggcagaaagaactggacggc
gcgctgatcgctcagatgaaaaagcccgcataa

DBGET integrated database retrieval system