KEGG   Sphingobium sp. EP60837: EP837_03741Help
Entry
EP837_03741       CDS       T04432                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
Organism
sphb  Sphingobium sp. EP60837
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANI80123
UniProt: A0A173L489
LinkDB All DBs
Position
pEP1:complement(59932..61410)
Genome map
AA seq 492 aa AA seqDB search
MSAREILLSHPNSLFIGGKWIAPSTSKTVQVLDSATEEQVLETAEANVDDVDRAVAAARA
SFDGGAWSGLKPVERAAYLREISAAVRRRQKEFANAWSLESGILYSRAQAVGDIITGVLN
RAADLADTFTFEEPHRSITGMKATLVREPVGVVAAIIPWNGPAPLTAYKLGSALLAGCTM
VIKMSPEAPAAGYLFAEIFEEIGLPAGVANVIVADREASQALVADNRVDKIAFTGSTAAG
RSIASACGQRIARYTLELGGKSPAIILDDFDIETAARTIGGGVSSLTGQVCHSLTRIIVP
RRRQEQMVEAVSAYFATLKIGDQFDPASDVGPLSTGKHRETVERYIEIGKAEGARLAYGG
GRPNELNRGYYVEPTLFADVDNRSTIGQEEIFGPVLAVIPVENEEEAVQIANDSIFGLNA
SIFTNDGDRFRHLARRLRSGTVGQNASRTDVSIGFGGFKQSGIGREGGVEGLLAYLESKV
VVTDQPIEEVAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctagagagattctgctatcgcacccgaactcgcttttcattggcggtaagtgg
attgcgccttcgaccagcaagacagtccaggtactcgattctgctaccgaggagcaggtt
cttgagacggcggaagcaaacgtcgacgacgtcgaccgagcggtagccgccgcccgtgca
tccttcgatggcggcgcttggtccggactgaagccggtggagcgtgcagcctatctgcgc
gaaatttccgctgccgtgcgtcgccgccaaaaggaatttgccaatgcttggtcgcttgag
tcaggcatcctctacagtcgcgcacaggcggtgggcgacattatcaccggcgttctcaac
cgcgctgctgacctggcggatacctttacgttcgaagaaccgcaccggtctatcaccggg
atgaaggcgacgctcgtgcgggagccagttggcgtcgtcgccgctatcattccctggaac
ggtcccgcgccactaacggcctataaactggggtccgcgctgctcgccggatgcacgatg
gtgatcaagatgtcgcccgaagctccggcggcaggttatctctttgcagaaattttcgag
gagatcgggctgccggccggcgttgcgaacgtcatcgtcgcggatcgtgaggcgtcccaa
gcgcttgtggctgacaatcgagtcgacaagatcgcgtttaccggctcgacggcagcggga
cgcagcattgcctcggcctgcgggcaacgtatcgcgcgctacacgctggaactgggcggc
aaatcacccgcgatcatactggacgacttcgacatcgagaccgccgcgcggacgattggt
ggtggcgtaagctcgctgaccgggcaggtctgccacagtctgacacgtattatcgttcct
cgccgacggcaagagcagatggttgaggcggtgagcgcttacttcgcaacactaaaaatc
ggcgaccagttcgatccggcgagcgacgtcggacctctgtcgacgggcaagcatcgcgag
acggtcgagcgctacatcgaaatcggcaaggctgaaggagcccggctagcgtacggtggt
ggacggccgaacgagcttaaccggggctattatgtcgaaccgacgctgtttgccgatgtc
gataaccgctccacaatcgggcaggaggaaatattcggccccgtcctggcagtcatccca
gtggagaatgaagaagaggcagtgcaaatcgccaatgactctatcttcgggctgaacgcg
tcgatcttcaccaatgacggtgaccgtttccggcatctggcgagacgcctgcggtccggg
acggtaggccagaacgcctcgaggacggatgtcagcattgggttcgggggcttcaagcaa
tccgggattgggcgcgaagggggagtcgaaggcctgctcgcctatctggagtcaaaggtc
gtagtcaccgatcagcccatcgaagaggtcgccggctga

DBGET integrated database retrieval system