KEGG   Sphingomonas sp. Cra20: CVN68_07970Help
Entry
CVN68_07970       CDS       T05307                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc00473  D-Alanine metabolism
sphc00550  Peptidoglycan biosynthesis
sphc01100  Metabolic pathways
sphc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CVN68_07970
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CVN68_07970
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CVN68_07970
Enzymes [BR:sphc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CVN68_07970
Peptidoglycan biosynthesis and degradation proteins [BR:sphc01011]
 Precursor biosynthesis
  Amino acid ligase
   CVN68_07970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ATY31913
UniProt: A0A2K8MDH5
LinkDB All DBs
Position
complement(1749473..1750396)
Genome map
AA seq 307 aa AA seqDB search
MTGGLHIAVLMGGWSAEREVSLMSGNGIADALESLGHRVNRVDMERNVAVKLAELKPDLV
FNALHGTPGEDGAVQGMLDLMGLKYTHSGLVTSVIAIDKQLTKQALVPHGIPMPGGRMVR
SEELYERDPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIGRDVRGPWQEFDELLAEPFI
RGRELTTAVLGDQALGVTELKPKSGFYDYDAKYTEGLTDHIFPADIPEDVADACKRIAID
AHRLLGCKGCSRSDFRWDDSQGVDGLFLLEVNTQPGMTPLSLVPEQARHLGISYAELVQR
IVDEALA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggggcctccacatcgccgtgctgatgggtggttggtccgccgagcgggaagtc
tcgctgatgtcggggaacggcatcgccgatgcgctcgagagcctcggccaccgggtcaac
cgcgtcgacatggagcgcaacgttgcggtcaagctcgccgaattgaagcccgatctcgtg
ttcaacgcgctccacggcacccccggcgaagacggggcggtgcagggcatgctcgatctg
atggggctgaaatatacccattcggggctcgtcacctcggtgatcgcgatcgacaaacag
ctcaccaaacaggcgctggtgccgcacggaatcccgatgcccggcgggcggatggtacgc
agcgaggaattgtacgagcgcgatcccctgccgcggccttatgtgctcaagccggtcaac
gaaggttcgtcggtaggcgtggcgatcgtcaccgccgagggcaattacggcaatccgatc
ggacgcgacgtgcgtgggccgtggcaggaattcgacgaattgctcgccgaacccttcatc
cgcggacgcgagctgaccacggcggtgctcggcgatcaggcgctcggcgtcaccgaattg
aagcccaagagcggcttctatgattacgacgccaaatataccgaggggctgaccgaccac
atcttccccgccgacatcccagaggacgtcgcggatgcgtgcaagcggattgcgatcgat
gcgcatcggcttctcggctgcaagggctgctcgcgctcggacttccgctgggacgacagc
cagggcgtcgacgggctgtttctgctcgaggtcaatactcagccggggatgacgccgctc
agcctcgtccccgaacaggcgcgccatctcggcatctcctatgccgaactggtccagcgc
atcgtcgacgaggcactcgcttga

DBGET integrated database retrieval system