KEGG   Sphingomonas sp. Cra20: CVN68_12350Help
Entry
CVN68_12350       CDS       T05307                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CVN68_12350 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sphc03400]
    CVN68_12350 (ligD)
Enzymes [BR:sphc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CVN68_12350 (ligD)
DNA repair and recombination proteins [BR:sphc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CVN68_12350 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ATY32668
UniProt: A0A2K8MFK8
LinkDB All DBs
Position
complement(2736868..2739333)
Genome map
AA seq 821 aa AA seqDB search
MAAKSDPLEKYNAKRDFALTAEPAGKIVRTGGNRFMVQKHDASRLHWDFRIEVDGVLKSW
AVTRGPSLDPDEKRLAVRTEDHPLSYADFEGTIPKGQYGGGTVMLWDDGVWEPIEGKSAS
DLEKGHLHFRLEGERMKGEWLLIRLKPRGKEKSENWLLRKISDKHAGATDFLVETGLTSI
KTGRTMQEIAEGKKVEKRPAKASPQTTARVARHAAPAKAKLPKFQHPQLATLVDSVPTGN
QWLHEVKYDGYRALIATGAKGPKIYTRSGLDWTDKFPGIAEAARGLPAPALIDGEIIAYK
DGKPDFSTLQEAISAGGQDLTFFAFDLLADREDTTRLPQLARKEKLRALLEGADARIQFS
EHIVGAGEELFETMCREGYEGIVSKRADAPYRGTRTKSWLKVKCIRRQEFVIVGWTPSDA
KGRSFRSLLLAVNGPDGLVYAGKVGTGFNQARLQDLRDRFDRIAVDQAPVKVPRPEARGA
RWIEPKLVAEVAFSEFTAENVIRHASFIALREDKKPGEIVAEKPAPLSENSAAPQSSIKI
SSRDRVIYPESGLTKGELADYYAAVAPIALRWLGNRPISLVRCPQGRAKHCFFQKHDAGS
FGDNVHHVDVREKDGSVQPYLYVDDLDGIMACVQMGTIEFHGWGAPVTDIEKPDRLVFDL
DPDEGLDFAMVKKAAEDLKVHLADIGLTSWPLLSGGKGVHVVVPLIPQADWPVVRSFAER
FARALAQAEPERFTANLKKLNRKGKIFIDYLRNQRGATAVLPYVARARENAPVAAPVTWS
ELRDLEDAKRYTIRDAAILLERATSRALQGWGEAGQALPDL
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaagtccgaccccctcgaaaaatacaatgccaagcgcgactttgccctgacc
gccgagcccgccggcaagatcgtgcgcaccggcggcaatcgcttcatggttcagaagcac
gacgcgagccggctccattgggatttccgtatcgaggtggacggcgtgctcaagagctgg
gcggtcacgcgcggccccagtctcgacccggacgagaagcgcctcgccgttcgcaccgag
gatcatccgctgtcctatgccgatttcgaaggcacgatccccaagggccaatatggcggc
ggcacggtgatgctgtgggacgacggcgtctgggaaccgatcgaaggcaagagcgccagc
gacctcgaaaagggccacctccatttccgcctcgaaggcgagcggatgaagggcgagtgg
ctgctcatccgattgaagccgcgtggcaaggagaagagcgagaactggctgcttcgcaag
atcagcgacaaacatgccggcgccaccgattttctcgtcgaaacggggctgaccagcatc
aagaccggccggaccatgcaggagatcgccgagggcaagaaggtcgagaagcggcccgca
aaggcatcgccgcaaactaccgcgcgcgtcgccaggcatgccgcgccggcgaaggccaaa
ttgcccaaattccagcacccccagctcgccaccctcgtcgacagcgtcccgaccggcaat
caatggctccacgaagtcaaatatgacggctatcgcgcgctgattgccaccggcgccaag
ggccccaaaatctacacccgctcgggcctcgactggaccgacaaattccccggcatcgcc
gaggcagcgcgcggcctgcccgcccccgccctgatcgacggcgagatcattgcctataag
gacggcaagcccgatttctcgacgctgcaggaggcgatctccgcgggcggacaggacctc
accttcttcgccttcgacttgctcgccgatcgcgaggataccaccaggcttccccagctc
gcccgcaaggaaaagctgcgtgcgctgctagaaggcgccgacgcgcgcatacaattttcc
gaacacatcgtcggcgccggcgaggaattgttcgagacgatgtgccgcgaaggttatgaa
gggattgtctccaagcgcgccgacgcgccctatcgcggcacccgcaccaaatcctggctc
aaggtcaaatgcatccgccgccaggagttcgtcatcgtcggctggacgccaagcgatgcc
aaaggccgcagcttccgctcgctcctgctcgccgtcaatgggcccgacggcctggtctat
gccggcaaggtgggaacgggcttcaatcaggcgaggctccaggatcttcgcgatcgcttc
gacaggatcgccgtggatcaggcccccgtgaaagtcccccgtcccgaggcgcgtggtgcg
cggtggatcgagccgaaactcgtcgccgaagtcgccttcagcgaattcactgccgagaac
gtcatccgccacgccagcttcattgcattgcgcgaggacaagaagcccggcgagatcgtc
gccgagaagccggcgccgctttccgaaaactccgcagccccgcaatccagcatcaagatc
agcagccgcgatcgggtgatctaccccgaatcggggctcaccaagggtgagctcgccgat
tattacgcggcagtcgcgccgatcgcgttgcgctggctcggcaaccgcccgatcagcctc
gtccgctgcccgcaggggcgcgccaagcactgcttcttccagaagcacgacgccggcagc
ttcggcgacaatgtccaccatgtcgacgtccgcgagaaggacggcagcgtgcagccctat
ctctatgtcgacgatctcgacgggatcatggcctgcgtgcagatgggcacgatcgagttc
cacggctggggtgccccggtcaccgatatcgagaaacccgaccggctggtgttcgatctc
gatcccgacgaggggctcgatttcgccatggtcaagaaagcggccgaggatttgaaagtc
catctcgccgatatcggcctgaccagctggccgctgctatcgggcggcaagggggtgcac
gtcgtggtgccgctgatcccgcaggccgattggcccgtggtgcgcagcttcgccgagcgc
ttcgcccgcgcgctcgcccaggccgagccggaacgcttcaccgccaatctcaagaagctc
aaccgcaagggcaagattttcatcgactatctgcgcaaccagcgcggcgcgactgcggtc
ctcccttatgtcgcccgcgcccgcgagaatgcgccggtcgccgcgccggtcacctggagc
gagctgcgcgacctcgaggatgccaagcgctatacgatccgcgacgctgccatcttgctc
gagcgcgccaccagccgcgcgctgcagggttggggggaagccgggcaggcattgcccgac
ctctag

DBGET integrated database retrieval system