KEGG   Sphingomonas sp. Cra20: CVN68_12615Help
Entry
CVN68_12615       CDS       T05307                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
sphc  Sphingomonas sp. Cra20
Pathway
sphc00040  Pentose and glucuronate interconversions
sphc00051  Fructose and mannose metabolism
sphc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CVN68_12615
   00051 Fructose and mannose metabolism
    CVN68_12615
Enzymes [BR:sphc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CVN68_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ATY32713
UniProt: A0A2K8MFR5
LinkDB All DBs
Position
2808453..2809451
Genome map
AA seq 332 aa AA seqDB search
MASQQKFGAGIWHFATYVDRYATDGYGPPRSLIEMIDLAGQVGDLSVVDINYPFPGGETD
FAAVEAALKRNNLDVIGITPEIYTREFARGAFTNPDAGVRRRANELVTEAADVVRRFGAD
YVKLWPGQDGWDYPFQVDHGDLWRMSMDGVGELAQANPDLKFVIEYKPREPRNHMSFDSV
ARTLLGIEKIGLPNVGILLDFGHSLYGGESPADAAQLAIDHGRLFGMDVNDNFRGWDDDM
IAGSVHPIELFEFFYTLRKNKWEGVWQLDQFPFREDCVGAAKSAIGFLKHIEGALDRLDF
DAMRAAQAKQDAVAALDLARAALFQSGPSSPR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccagcagaagttcggcgcgggaatctggcatttcgcgacctatgtcgatcgc
tatgcgaccgacggctacggcccgccgcgctcgctgatcgagatgatcgacctcgccggg
caggtcggcgatctgtcggtggtcgacatcaactatcccttcccgggcggcgagaccgat
ttcgctgccgtcgaagcggcgctcaagcgcaataatctcgacgtgatcggcattacgccc
gaaatctacacccgcgaattcgcgcgcggcgccttcaccaatcccgacgccggggtgcgc
cgccgcgccaacgaactggtcaccgaagccgccgacgtcgtccgccgcttcggcgcggat
tacgtcaagctctggcccggccaggacggctgggactatcccttccaggtcgatcacggc
gatctctggcggatgagcatggacggcgtaggcgagcttgcccaggccaatcccgacctg
aagttcgtcatcgaatataagccgcgcgagccgcgcaatcacatgagcttcgacagcgtt
gcgcggaccttgctggggatcgagaagatcggcctccccaatgtcggcatcctgctcgat
ttcggtcattcgctctacggcggcgaatctcctgccgatgccgcccaattggcgatcgac
catggccggctgttcggcatggacgtcaacgacaatttccgcggctgggatgacgacatg
atcgccggctcggtgcatcccatcgaactgttcgaattcttctacacgttgcgcaagaac
aagtgggaaggcgtgtggcagctcgaccagtttccgttcagagaagattgcgtcggagcc
gcgaaaagcgcgatcggctttctcaagcacatcgagggcgcgctcgaccgtctcgacttc
gatgcgatgcgcgccgcgcaggcgaagcaagacgcagttgccgcgctcgatctggcgcgc
gccgccttgttccagtcggggccctcgtccccgcgctga

DBGET integrated database retrieval system