KEGG   Sphingomonas wittichii DC-6: HY78_04510Help
Entry
HY78_04510        CDS       T05200                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphd  Sphingomonas wittichii DC-6
Pathway
sphd00473  D-Alanine metabolism
sphd00550  Peptidoglycan biosynthesis
sphd01100  Metabolic pathways
sphd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HY78_04510
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HY78_04510
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HY78_04510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphd01011]
    HY78_04510
Enzymes [BR:sphd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HY78_04510
Peptidoglycan biosynthesis and degradation proteins [BR:sphd01011]
 Precursor biosynthesis
  Amino acid ligase
   HY78_04510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ARR52759
UniProt: A0A1X9UB08
LinkDB All DBs
Position
937690..938628
Genome map
AA seq 312 aa AA seqDB search
MTRPLHIAVLMGGWSSEREVSLTSGNGVADALESLGHKVTRIDMDRDVALRLAEAKPDVV
FNALHGTPGEDGTVQGMMDLMGLTYTHSGLTTSVIAIDKELTKQQLVPHGIRMPEGIIVE
SESLHAGDPMPRPYVLKPVNEGSSVGVAIIKERDNHGVPIHRDSHGPWQTFATLLAEPFI
RGRELTVAVLGDRALGVTELVPSSGFYDYEAKYTDGLTTHICPADVPADIAEAAMRMALD
AHRLLGCKGTSRSDFRWDDERGEAGLYLLEVNTQPGMTPLSLVPEQARHVGLTYADLVQA
IVDEALAGKAAR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtcccctccacatcgcggtgctgatgggcggctggtcgtcggagcgcgaggtg
tcgctgacctcgggcaacggcgtcgccgacgcgctcgaaagcctgggccacaaggtgacg
cggatcgacatggaccgcgacgtcgccctgcgcctggccgaggcgaagcccgacgtggtg
ttcaacgcgctgcacgggacgccgggcgaggacggcaccgtccagggcatgatggacctg
atggggctgacctacacccattcggggctgaccacctcggtcatcgcgatcgacaaggag
ctgaccaagcagcagctcgtcccccacggcatccgcatgccggagggcatcatcgtcgag
agcgagagcctccatgccggcgatccgatgccgcgcccctatgtgctcaagcccgtcaac
gagggatcgtcggtcggcgtcgcgatcataaaagaacgtgacaatcacggcgtgccgatt
catcgtgactcgcatggcccgtggcagaccttcgcgaccctgctggcagagcccttcatc
cgggggcgcgagctgaccgtcgcggtgctcggcgatcgcgccctgggcgtgaccgagctg
gtccccagcagcggcttctatgactatgaagccaaatataccgacgggctgaccacccat
atctgccccgccgacgtccccgccgacatcgccgaggcggcgatgcggatggcgctcgac
gcgcaccggctgctcggctgcaagggcacgtcgcgctccgacttccgctgggacgacgaa
cggggcgaggccggcctctacctgctcgaggtcaacacccagccgggcatgaccccgctg
agcctggtccccgaacaggcgcgccatgtcggcctgacctatgccgacctggtccaggcg
atcgtcgacgaggcgctggccgggaaggccgcgcgatga

DBGET integrated database retrieval system