KEGG   Sphingomonas sp. DC-6: HY78_09890Help
Entry
HY78_09890        CDS       T05200                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphd  Sphingomonas sp. DC-6
Pathway
sphd00620  Pyruvate metabolism
sphd00680  Methane metabolism
sphd01100  Metabolic pathways
sphd01120  Microbial metabolism in diverse environments
sphd01200  Carbon metabolism
Module
sphd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HY78_09890
  09102 Energy metabolism
   00680 Methane metabolism
    HY78_09890
Enzymes [BR:sphd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HY78_09890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: ARR53706
UniProt: A0A1X9UDX7
LinkDB All DBs
Position
complement(2034295..2036976)
Genome map
AA seq 893 aa AA seqDB search
MSSTPPITQNPDIRFLGRLLGDVIRVYGGEALFRRIEYIRSASVDRARGIVGSHEIDSGL
GALTLDDTLAFVRGFMLFSMLANLAEDRQGIAAEPGADVAAALDRLEKEGISRAKVVEML
DRALIVPVLTAHPTEVRRKSMIDHRNKIAELMTLKDIGRTETVDGDLIDQAIYRQIALLW
QTRPLRRERLYVADEVETALAYLRDIFLPTLPALYSRWQRALGHRPASFLKPGSWIGGDR
DGNPFVTADSLRLALSRSAETVIGYYLRELHELGAELSISTELAEVTWEVEKLAEASGDK
SSTRSDEPYRRAITGIYSRLSKTYEKLTGRLPARLPATDAEGGAYEDPAALRADLVEIAH
ALNRTGADSLAGNGALGRLIRAVETFGFHLATLDMRQNADVHERVVADLLRVAGVEADYG
ALDEPARVALLRSELASKRLLRTPFGAYADETLSELAIVEAAAEAHRRYGPAAITTYLIS
KAESVSDMLEVNILLKEAGLFVPGDPPTAAIMAVPLFETIGDLDRAPEVMTQWFALPEVA
AITAARGHQEVMVGYSDSNKDGGYLTSVWSLHEASSALKPVFAKANSALQLFHGRGGAVG
RGGGSSFAAILAQPHGTVQGRIRITEQGEVIAAKYGTRESAAANLEAMASATLLATLEED
ALQPKDAKRFFAAMDEISANAFKAYRGLVYDTEGFRTFFRQMTPIAEIADLKIGSRPASR
TRSDRIEDLRAIPWVFSWAQARVMLPGWYGVGHGLKGFKDIGLLREMLEAWPFFQSTLAN
LEMVLAKSDMDIAERYVALVEDEAMGRDIFGRIRDGWQRTQEALLSVTRQTRLLQKNPSL
DQSIRLRLPYIEPLNLLQIELLKRHRAGEDDPRVREGIQLSINAIATALRNSG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcacgccgcccatcacccagaaccccgacatccgcttcctcggccgcctgctc
ggcgacgtgatccgcgtctatggcggcgaggcgctgttccggcggatcgaatatatccgc
tcggcgtcggtcgatcgggcgcgcggcatcgtcggctcgcacgagatcgattcggggctc
ggcgcgctgaccctcgacgacacgctcgccttcgtgcgcggcttcatgctcttctcgatg
ctcgccaacctcgccgaggaccggcagggcatcgccgccgagcccggcgccgacgtcgcc
gccgcgctcgaccggctggagaaggaaggcatctcgcgcgccaaggtggtcgagatgctc
gaccgggcgctgatcgtgccggtgctcaccgcccacccgaccgaggtgcggcgcaagagc
atgatcgaccatcgcaacaagatcgccgagctgatgacgctcaaggacatcggccggacc
gagaccgtcgacggcgacctgatcgaccaggcgatctaccggcagatcgcgctgctctgg
cagacccggccgctgcgccgcgagcggctctatgtcgccgacgaggtggagaccgcgctc
gcctatctgcgcgacatcttcctgccgacgctccccgcgctctattcgcgctggcagcgc
gcgctcggccaccgtccggcgagcttcctgaagccgggaagctggatcggcggcgatcgc
gacggcaaccccttcgtcaccgccgattcgctgcgcctggctttgtcgcgctcggccgag
acggtgatcggctattatctgcgcgagctgcacgaattgggcgccgagctgtcgatctcg
accgagctggccgaggtgacctgggaggtcgagaagctcgccgaggcgtcgggcgacaag
agctcgacccgcagcgacgagccctatcgccgcgcgatcaccggcatctattcgcgcctg
tccaagacctatgagaagctgaccggccgcctgccggcgcggctgccggcgaccgatgcc
gagggcggcgcctatgaggacccggccgcgctgcgcgccgacctggtcgagatcgcccat
gcgctcaaccgcaccggcgccgactcgctcgccggcaacggcgcgctcggccggctgatc
cgcgccgtcgagaccttcggcttccatctcgcgacgctcgacatgcgccagaatgccgac
gtccacgagcgcgtcgtcgccgacctgctcagggtcgccggggtcgaggccgactatggc
gcgctcgacgagcccgcgcgcgtcgcgctgctgcggagcgaactggcgtcgaagcggctg
ctgcgcaccccgttcggcgcctatgccgacgagacgctgtccgagctcgcgatcgtcgaa
gccgccgccgaggcgcatcgccgctacgggcccgcggcgatcaccacctatctgatctcg
aaggccgagagcgtgtcggacatgctcgaggtcaacatcctgctcaaggaggccgggctg
ttcgtccccggcgatccgcccaccgcagcgatcatggcggtgccgctgttcgagacgatc
ggcgacctcgaccgcgcgcccgaggtgatgacgcagtggttcgcgctgcccgaggtggcg
gcgatcaccgccgcgcgcggccatcaggaggtgatggtcggctattcggattcgaacaag
gacggcggctacctcacctcggtgtggagcctgcacgaggcgtcgagcgcgctgaagccg
gtgttcgccaaggcgaacagcgcgctccagctcttccacgggcggggcggcgcggtcggg
cgcggcggcgggtcgagcttcgcggcgatcctcgcccagccgcacggcacggtgcagggc
cgcatccgcatcaccgagcagggcgaggtgatcgccgccaaatatggcacgcgcgagagc
gccgccgccaatctggaggcgatggcctcggccacgctgctcgccacgctggaggaggac
gcgctccagcccaaggacgccaagcgcttcttcgccgcgatggacgagatctcggccaat
gcgttcaaggcctatcgcggcctggtctatgacaccgagggcttccgcaccttcttccgc
cagatgacgccgatcgccgagatcgccgacctcaagatcgggtcgcgcccggcgagccgg
accaggagcgaccggatcgaggacctgcgcgccatcccctgggtgttcagctgggcgcag
gcacgggtgatgctgcccggctggtacggcgtcggccatggcctcaagggcttcaaggac
atcggcctgctgcgcgagatgctggaggcctggcctttcttccagtcgaccctcgccaat
ctggagatggtgctcgccaagtcggacatggacatcgccgagcgctatgtcgcgctggtc
gaggacgaggcgatgggccgcgacatcttcggccgcatccgcgacggctggcaacggacg
caggaggcgctgctgtcggtcacgcggcagacccgcctgctccagaagaacccgtcgctc
gaccagtcgatccggctgcgcctgccctatatcgagccgctgaacctgctccagatcgag
ctgctcaagcgccaccgcgcgggcgaggacgacccccgcgtccgcgagggcatccagctc
tcgatcaacgcgatcgcgaccgcgctgcgcaacagcgggtga

DBGET integrated database retrieval system