KEGG   Sphingomonas sp. DC-6: HY78_12175Help
Entry
HY78_12175        CDS       T05200                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sphd  Sphingomonas sp. DC-6
Brite
Enzymes [BR:sphd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     HY78_12175
Peptidases [BR:sphd01002]
 Metallo Peptidases
  Family M2
   HY78_12175
Exosome [BR:sphd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HY78_12175
CD molecules [BR:sphd04090]
 Proteins
  HY78_12175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ARR54139
UniProt: A0A1X9UEY8
LinkDB All DBs
Position
complement(2523899..2525761)
Genome map
AA seq 620 aa AA seqDB search
MKLSIKAATSALALAALLATAPALAEEQQPVAATAANASAAAPTTAEADAFVADAEKQLA
DLGIYGAQVAWINATYITDDTDAVNARVGAEFTEMQVRYASGAARFDGLKGLSYDTRRKL
DILKQSIVLPAPATAGAAKELNDLATRLQSAYGKGKGTLRGEEINGSDIEAAMGTNRNPA
ELKEMWVSWHDNVGRPMRGDYAKLVEIANKGAVDLGYKDLGAMWRAGYDMPADDFAKMMD
RLWTQVKPLYDALHCYTRTKLNEKYGDAVQAKTGPIRADLLGNMWAQEWGNIYDIVAPKG
AGDLGFDIGDLLVAKQYDPVKMVKAGEGFYTSLGFDKLPDSFWARSQITKPRDREVVCHA
SAWDIDNVDDLRIKMCTKVNSDDFVTIHHELGHNFYQRAYNKQPYLYLNGANDGFHEAIG
DFIALSVTPDYLVRIGLLDPAKVPSADKDIGLLLRQAMDKVAFLPFGLLMDKWRWGVFSG
QISPASYNKAWTDLRLQYQGIVPPEARDEGDFDPGAKYHIPGNTPYARYFLARILQFQFY
KAACEQAGWKGPLHRCSFYGNKEVGAKLDAMLKMGASKPWPDALQAFTGSREIDGSAMIA
YFKPLMTWLEKQNKGQRCGW
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctcgatcaaggcggcgacgtccgcgctggcgctcgccgcgctgctcgccacc
gccccggccctcgccgaggaacagcagcccgtcgccgccacggccgccaacgcgtcggcc
gccgcgcccacgaccgccgaggccgacgccttcgtcgccgatgcggagaagcagctcgcc
gatctcggcatctacggcgcgcaggtggcgtggatcaacgcgacctacatcaccgacgac
accgacgcggtgaacgcccgcgtcggcgccgagttcaccgagatgcaggtccgctatgcc
agtggagcggcgcgcttcgacgggctgaaggggctgagctacgacacccgccgcaagctc
gacatcctcaagcagagcatcgtcctgcccgcccccgccacggcgggcgccgccaaggag
ctcaacgacctcgcgacccggctccagtcggcctatggcaagggcaaggggacgctgcgc
ggcgaggagatcaacggctccgacatcgaggcggcgatgggcaccaaccgcaaccccgcc
gagctgaaagagatgtgggtcagctggcacgacaatgtcggcaggccgatgcgcggcgac
tatgccaagctggtcgagatcgccaacaagggcgcggtcgacctcggctacaaggatctc
ggcgcgatgtggcgcgcgggctacgacatgcccgccgatgatttcgcgaagatgatggac
cggctgtggacgcaggtgaagccgctctacgacgcgctccactgctacacccgcacgaag
ctcaacgagaaatatggcgacgccgtccaggcgaagaccggcccgatccgcgccgacctg
ctcggcaatatgtgggcgcaggaatggggcaatatctacgacatcgtcgcgccgaagggc
gcgggcgacctgggcttcgacatcggcgacctgctcgtcgccaagcagtacgacccggtc
aagatggtcaaggcgggcgagggcttctacacctcgctcggcttcgacaagctgcccgac
agcttctgggcccgctcgcagatcaccaagccgcgcgaccgcgaggtggtgtgccacgcc
tccgcctgggacatcgacaatgtcgacgacctgcggatcaagatgtgcaccaaggtgaac
tcggacgacttcgtcacgatccaccacgagttgggccataatttctaccagcgcgcctac
aacaaacagccctatctctacctcaacggcgccaatgacggcttccacgaggcgatcggc
gacttcatcgcgctgtcggtgactcccgactatctggtgcggatcggcctgctcgacccg
gcgaaggtgccgagcgcggacaaggacatcgggctgctgctgcgccaggcgatggacaag
gtcgccttcctgcccttcggcctgctgatggacaaatggcgctggggcgtgttcagcggc
cagatcagcccggccagctacaacaaggcgtggaccgacctgcgcctgcaatatcagggc
atcgtcccgcccgaggcgcgcgacgagggcgatttcgatccgggcgccaaataccacatc
cccggcaacacgccctatgcgcgctacttcctcgcccgcatcctccagttccagttctac
aaggcggcgtgcgagcaggccggctggaaggggccgctccaccgctgctccttctacggc
aacaaggaggtcggggcgaagctcgacgcgatgctgaagatgggcgcgtccaagccctgg
cccgacgcgctgcaggccttcaccggcagccgcgagatcgacggctcggcgatgatcgcc
tatttcaagccgctgatgacctggctcgaaaagcagaacaagggccagcgctgcggctgg
tga

DBGET integrated database retrieval system