KEGG   Sphingomonas wittichii DC-6: HY78_18085Help
Entry
HY78_18085        CDS       T05200                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sphd  Sphingomonas wittichii DC-6
Pathway
sphd00040  Pentose and glucuronate interconversions
sphd00051  Fructose and mannose metabolism
sphd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HY78_18085
   00051 Fructose and mannose metabolism
    HY78_18085
Enzymes [BR:sphd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     HY78_18085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ARR55216
UniProt: A0A1X9UIA9
LinkDB All DBs
Position
3806940..3808022
Genome map
AA seq 360 aa AA seqDB search
MNETMRAAVLEGPGKIAVKDVPMPEIGEADVLIRVVNCGICGSDVHSFKTGLYVKPGQVM
GHEFMGHIAMVGDKVDGMAVGDRVTGFSASICGECDACKRGQYILCAKLFTGSTGYGLAG
AFAEYVKIENALLGSNVHKLPDTIDDISAAMIEPVSVGVAAAVQANVQPGDKVVVLGVGM
IGNACLQAAKAAGAAEVIAVDVSLTRLEIARQSGADDVFDARNGDATEWVKQKFGIAPYH
YNEGGNADVVFEAAGIPLTIQQSLEMVRPGGMICIVGLPEHAAEIDTTKIVHKMPRIVGS
LGGDFAPAIARLASGAIKVRHLMTHSFPLEEAAEAFAVQLKAGETVKVIINAGPEVPAAA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacgatgcgggccgctgtgctggaaggccccggaaagatcgcggtcaaggac
gttccgatgcctgagattggcgaggcggatgtgctcatccgcgtcgtgaattgcggcata
tgcggatcggacgtgcacagtttcaaaacgggcctgtatgtaaagccgggccaagtgatg
ggccatgaattcatgggccatatcgccatggtcggcgacaaggtggacgggatggccgtc
ggcgaccgagtgaccggcttttccgcgagcatttgcggcgaatgcgacgcgtgcaagcgc
ggacaatatatattgtgcgcgaaactgttcaccggctcgactggctatggccttgccggc
gcctttgccgaatatgtgaagatcgagaatgcgctgctcggcagcaatgtccacaagctg
cccgatacgatcgacgatatttcagcggcgatgatcgagccggtttcggtgggtgtcgcc
gctgcggttcaggccaatgtccagcccggcgacaaggtggtcgtgctcggcgtcgggatg
atcggcaacgcttgtttgcaagccgcgaaggctgccggagcggcggaggtgatcgcggtg
gatgtcagtctcacccgcctcgaaatcgccaggcagagcggcgcggacgatgtctttgac
gcgcggaacggcgacgccactgaatgggtgaagcagaagttcggcatcgcaccttaccat
tataatgagggcggcaatgccgatgtcgtattcgaggcggcaggcatccctctcactatc
cagcaatcgctggagatggtgcgtccgggtggtatgatctgcatcgtgggcctgcccgaa
catgccgcggaaatcgataccaccaagatcgtccacaaaatgcccaggatcgtcggatcg
ctggggggggatttcgcgcccgccatcgccaggctggcttcgggcgcgatcaaggtgcgt
catctgatgacgcacagcttcccgctcgaagaggcggcggaggcgtttgctgttcagctc
aaggctggggaaacggtgaaggtgatcatcaacgccggtcccgaggttccggcggcagca
taa

DBGET integrated database retrieval system