KEGG   Sphingomonas sp. DC-6: HY78_22660Help
Entry
HY78_22660        CDS       T05200                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sphd  Sphingomonas sp. DC-6
Pathway
sphd00473  D-Alanine metabolism
sphd01100  Metabolic pathways
sphd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HY78_22660
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HY78_22660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphd01011]
    HY78_22660
Enzymes [BR:sphd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HY78_22660
Peptidoglycan biosynthesis and degradation proteins [BR:sphd01011]
 Precursor biosynthesis
  Racemase
   HY78_22660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARR56052
UniProt: A0A1X9UJR3
LinkDB All DBs
Position
complement(4784476..4785612)
Genome map
AA seq 378 aa AA seqDB search
MTANDAAAGAILRIDLDAIIDNYRLIQQRAAPAEVAAVVKADAYGLGAARVAAALRDAGC
RRFFVAHLVEAARLREAIGDGVEIGVLNGLQPGAETACAELGAVPVLNALDQIERWAALA
RASGARLPCMIQFDTGMSRLGLAPGEVRALIDRPERLDGLDIRLIMSHLACADEPERASN
QHQAQAFDAFCARFPGIPRSLDNSGGALLPRAHHYDVVRAGIALYGGAPQTGPNPMHPVV
TLDARVIQLRTVEPGTAVGYGLTHRFDRPARLATLSVGYADGWPRSLGNRGAAYVAGHRA
PIVGRISMDSLTIDVSDIPEELLLPGSLIELIGPHQSIDDIARDAGTISYEILTQLGHRY
ARSYLPSPSLHQRKAAQP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaacgatgcagccgccggtgcgatccttcggatcgacctcgatgcgatcatc
gacaattaccgcctgatccagcaacgggcggcgcccgccgaggtcgccgccgtggtcaag
gccgacgcctatggactgggcgcggcgcgggtcgcggcggcgttgcgggacgccggctgc
cggcggttcttcgtcgcccatctcgtcgaggcggctcggttgcgcgaggcgatcggcgac
ggcgtcgagatcggcgtcctcaacggcctccagcccggcgccgagacggcctgcgccgaa
ctgggcgcggtgccggtgctcaacgcgctcgaccagatcgagcgctgggcggcactggcg
cgcgcgtcgggcgcccgcctgccgtgcatgatccagttcgacaccggcatgtcgcggctc
ggtctcgcgcccggcgaggtccgggcattgatcgaccggcccgagcggctcgacggcctc
gacatccgtcttatcatgagccacctggcctgcgccgacgagcccgaacgggcatccaac
cagcatcaggcgcaggcgttcgacgccttctgcgcgcggtttcccggcatcccccggtcg
ctcgacaatagcggcggcgcgctgctgccgcgcgcccatcattatgacgtcgtccgggcc
ggcatcgcgctctacggcggcgcgccccagaccggtccgaacccgatgcacccggtcgtc
acgctcgacgcccgagtcatccagctccgcacggtcgagccgggaaccgcggtcggctat
ggcctgacgcatcggttcgaccggccggcgcggctcgccacgctgtcggtcggctatgcc
gacggctggccacgttcgctcggcaatcggggcgcggcctatgtcgcgggccatcgcgcc
ccgatcgtcggtcgcatctcgatggacagcctgacgatcgacgtgtccgacattccagag
gagctcctccttccggggagcctgatcgagctgatcggcccccatcagtcgatcgacgac
atcgcgcgcgacgccgggaccatctcctacgagatattgacccagctcggccatcgctat
gcgcggagctacctcccctctccttccctccatcagcgaaaggcagcgcagccatga

DBGET integrated database retrieval system