KEGG   Sphingomonas wittichii DC-6: HY78_26190Help
Entry
HY78_26190        CDS       T05200                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sphd  Sphingomonas wittichii DC-6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ARR56680
UniProt: A0A1X9ULI8
LinkDB All DBs
Position
complement(5556053..5557528)
Genome map
AA seq 491 aa AA seqDB search
MTDTLLNLSNPEKLFIGGDWAASSDADGIEIVSPSTEEVVGRVGKAGRADMDRVVAVARH
AFDHGPWPRMIGAERAAVLRRIAGEMGKRADDFARAWSLQVGMPYAQSSMTAPYMAAYLT
YFADLAEKGFEEVRQPMMGGHCIVVHEPVGVVAAVVPWNAPLATLLLKVAPALAAGCAVI
AKPSPETPLEALILAECIAAAGVPEGVFSVLTADREVSDHLIRNPGIDKVSFTGSTAAGL
HIASVCGGRMARVTTELGGKSAAIVLDDATIETVVAGIMPNLVGLCGQQCAAFSRILVSA
ARKAEVIEAMAAAMQAVTVGDPFDQATQMGPLVTRNQHGRVFGYIEKGKAEGARLVTGGG
RPAHLPKGWFVEPTLFADASNDMAIAREEIFGPVGTIIAYDDEEQAIAIANDSNYGLSGG
VFTESPDRAYAVARRIRTGNFGHNGRVIDFTMPYGGFKQSGIGREGGIEGLRAFTEIKAV
FMPELPTHLRS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgctgctgaacctctccaatcccgaaaagctgttcatcggcggcgactgg
gccgcgtcgtcggacgccgacgggatcgagatcgtctcgccctcgaccgaggaggtggtc
ggccgtgtcggcaaggcgggcagggcggacatggatcgcgtcgtcgcggtggcgcgccat
gccttcgatcacggtccctggccgcgcatgatcggcgccgagcgcgccgccgtgctgcgc
cggatcgccggggagatgggcaagcgcgccgatgatttcgcgcgcgcctggtcgctccag
gtcggcatgccctatgcccagtcgtcgatgaccgcgccttacatggccgcctatctcacc
tatttcgccgacctcgccgaaaaggggttcgaggaggtgcgccagccgatgatgggcggc
cattgcatcgtcgtccacgagccggtcggcgtcgtcgcggcggtggtgccgtggaacgcg
ccgctggcgacgctgctgctcaaggtcgccccggcgctggcggcgggctgcgccgtcatc
gccaagccctcgcccgagaccccgctggaggcgctgatcctcgccgagtgcatcgccgcc
gccggcgtgcccgagggggtcttctcggtgctcaccgccgaccgcgaagtctccgatcac
ctgatccgcaaccccgggatcgacaaggtcagcttcaccggatcgaccgccgccgggctg
cacatcgcgtcggtctgcggcggccgcatggcgcgcgtcaccaccgaactgggtggcaag
tccgccgcgatcgtcctcgacgatgcgacgatcgagacggtggtcgccgggatcatgccc
aacctggtcggcctgtgcggccagcaatgcgccgccttcagccgcatcctcgtctccgcc
gcgcgcaaggccgaggtgatcgaggcgatggccgccgcgatgcaggcggtgacggtcggc
gatccgttcgatcaggcgacccagatgggcccgctcgtcacccgcaaccagcatggccgg
gtgttcggctatatcgagaagggcaaggccgagggtgcccgcctcgtcaccggcggcggg
cggccggcgcacctgcccaagggctggttcgtcgagccgaccctgttcgccgacgcgagc
aacgacatggcgatcgcgcgcgaggagattttcgggccggtcggcacgatcatcgcctat
gacgacgaggaacaggccatcgccatcgccaacgacagcaattatggcctgtccggcggc
gtgttcaccgaaagccccgaccgcgcctatgccgtcgcgcggcgtatccgcaccggcaat
ttcgggcataatggccgggtgatcgacttcaccatgccctatggcggcttcaagcagtcg
gggatcggccgcgagggcgggatcgaggggctgcgcgccttcaccgagatcaaggcggtc
ttcatgcccgaactcccgacgcatctgcggtcatga

DBGET integrated database retrieval system