KEGG   Sphingomonas sp. FARSPH: DM480_08355Help
Entry
DM480_08355       CDS       T05685                                 

Definition
(GenBank) cystathionine gamma-synthase family protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
sphf  Sphingomonas sp. FARSPH
Pathway
sphf00270  Cysteine and methionine metabolism
sphf00450  Selenocompound metabolism
sphf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DM480_08355
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DM480_08355
Enzymes [BR:sphf01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     DM480_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AXJ96938
UniProt: A0A345WTD6
LinkDB All DBs
Position
complement(1709534..1710877)
Genome map
AA seq 447 aa AA seqDB search
MPDRDTQPRETPLGGTEAELTGVPAPDAAPSTPKTIAGRKLKPSTLMMGHGFDPALSEGS
LKPPIFLTSTFVFPNAAAGKRHFEGVTGKRPGGAEGLVYSRFNGPNQEILEDRLSVWEEA
EDALAFSSGMSAIATLFLSMVKPGDTIVHSGPLYAATETLIARILGRFGVHWLDFPAGAT
RAEIDAVLSKAASGNVALIYLESPANPTNALVDVEAVRASRDAIFANAAVKPPIAIDNTF
LGPLWSKPLQHGADIVVYSLTKYAGGHSDLVAGGVLGTKEHINTIRAMRNTIGTICDPNT
AWMLLRSLETLELRMSRAGENAAKVCAFLRQHPKVESMGYLGFIEDARQKDIYERHCTGA
GSTFSLLVKGGEAEAFRFLDALKIAKLAVSLGGTETLASHPAAMTHLSVPEARKQALGIT
DNLVRISIGVEDADDLIADFDQALAAI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccgcgacacgcaaccgcgcgaaacccccctcggcggaaccgaagccgagctg
accggcgtgcccgcccccgacgcggcgcccagcacgcccaagacgattgccggccgcaag
ctcaagccctcgacgctgatgatgggccacggcttcgaccccgctttgtccgaaggatcg
ctcaaacccccgatcttcctcacctccaccttcgtcttccccaatgcggccgcaggcaag
cgccatttcgagggcgtgacgggcaagcggccgggcggggcggagggcctcgtctattcg
cgcttcaacgggccgaaccaggaaatcctcgaggatcgcctgtcggtgtgggaagaggcg
gaggacgcgctcgccttttccagcggcatgtcggcgatcgcgaccctgttcctgtcgatg
gtcaagcccggtgacacgatcgtccattcggggcccctctatgcggctaccgagacgctg
atcgcgcgcattctcggccggttcggcgtccactggctcgatttcccagcgggcgcgacg
cgcgccgagatcgacgcggtgctgagcaaggcggcgagcggcaacgtcgcgctcatctac
ctcgaaagccccgccaacccgaccaacgccttggtcgacgtcgaggcggtgcgcgccagc
cgcgatgcgatcttcgccaatgccgccgtgaaaccgccgatcgcgatcgacaacacgttc
ctggggccgctctggtcgaagccgctacaacatggcgcggacatcgtcgtctattcgctg
accaaatatgccggcggccattccgatctcgtcgccggcggcgtgctggggacgaaggag
cacatcaacacgatccgcgcgatgcgcaacacgatcggcacgatctgcgatcccaacacc
gcgtggatgctgctgcgcagcctcgagacgctggaactgcgcatgagccgcgcgggcgag
aatgccgccaaggtgtgcgccttcctgcgccagcatcccaaggtggagagcatgggctat
ctcggcttcatcgaggatgcgcgccagaaggacatctacgagaggcattgcaccggcgcg
ggatcgaccttctcattgctggtcaagggcggcgaggcggaagcgttccgcttcctcgac
gcgctgaagatcgccaagctcgcggtcagcctcggcggcaccgagacgttggcgtcgcat
ccggcggcgatgacgcatctgtcggtgcccgaagcgcgcaagcaggcgctgggcatcacc
gacaacctggtgcgcatctcgatcggggtcgaggatgcagacgacctgatcgccgatttc
gaccaggcgctggcggcgatctaa

DBGET integrated database retrieval system