KEGG   Sphingomonas sp. FARSPH: DM480_11480Help
Entry
DM480_11480       CDS       T05685                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphf  Sphingomonas sp. FARSPH
Pathway
sphf00473  D-Alanine metabolism
sphf00550  Peptidoglycan biosynthesis
sphf01100  Metabolic pathways
sphf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DM480_11480
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DM480_11480
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DM480_11480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphf01011]
    DM480_11480
Enzymes [BR:sphf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DM480_11480
Peptidoglycan biosynthesis and degradation proteins [BR:sphf01011]
 Precursor biosynthesis
  Amino acid ligase
   DM480_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AXJ96031
UniProt: A0A345WQS9
LinkDB All DBs
Position
2403341..2404282
Genome map
AA seq 313 aa AA seqDB search
MNALHIAVLMGGWSAERPVSLMSGAGVADALEANGHRVTRIDMGRDVAARLAEAKPDLVF
NALHGSPGEDGTVQGMLDLMGIPYTHSGLATSVIAIDKVLTKQALVPAGIPMPGGRVVKS
ADVFEADPIARPYVLKPVNEGSSVGVAIVTADGNYGDPIGRDVAGPWQEFDELLAEPYVR
GRELTTAVLGNRALGVTELKPKNGWYDFDAKYTDGLTEHVCPADIPDIIADACKRLALEA
HRLLGCKGASRSDFRWDDERGVDGLFLLEVNTQPGMTPLSLVPEQARHIGMSYEQLVQAI
VDEALADARGRDG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccctccacatcgccgtgctgatgggcggctggtctgccgaacgcccggtgtcg
ctgatgtcgggcgccggcgtcgccgacgcgctggaggcgaacggccatcgcgtcacgcgg
atcgacatgggtcgcgacgtcgccgcgcgccttgcggaggcgaagcccgacctcgtcttc
aacgcattgcatggatcgcccggcgaggatggcacggtgcagggcatgctcgacctgatg
ggcatcccgtacacccattcgggcctcgcgacctcggtgatcgcgatcgacaaggtgctg
accaagcaggcgctcgtccccgccggcatcccgatgccgggcggccgcgtcgtcaagtcc
gccgacgtgttcgaagccgatccgatcgcgcggccctatgttttgaagcccgtcaacgaa
ggatcgtcggtcggtgtcgcgatcgtcaccgcagacggcaattacggcgatccgatcggc
cgcgatgtcgcggggccgtggcaggagttcgacgaactgctcgctgaaccctatgtgcgc
ggccgcgaattgaccaccgcggtgctcggcaatcgcgcgctgggcgttaccgaattgaag
cccaagaacggctggtatgacttcgacgccaaatataccgacggtctgaccgagcacgtc
tgccctgcggacatccccgacattatagcggatgcgtgcaagcgtctggcgttggaggcg
catcgcctgctcggctgcaagggcgcgagccggtccgacttccgctgggacgacgaacgc
ggcgtcgacggcctgttcctgctcgaggtgaacacacagccgggcatgacgcccttgagc
ctcgtgcccgaacaggcgcgccacatcggcatgagctacgaacagctggtgcaggcgatt
gtggacgaagcgctcgccgacgcgcggggccgcgacggatga

DBGET integrated database retrieval system