KEGG   Sphingomonas sp. FARSPH: DM480_11750Help
Entry
DM480_11750       CDS       T05685                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphf  Sphingomonas sp. FARSPH
Brite
KEGG Orthology (KO) [BR:sphf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM480_11750
Enzymes [BR:sphf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DM480_11750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Glutaredoxin NAD_binding_7 DAO Thi4 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AXJ96080
UniProt: A0A345WQX8
LinkDB All DBs
Position
complement(2453039..2454622)
Genome map
AA seq 527 aa AA seqDB search
MLDANLTQQLKGYLVNIRQPIELVASLGEDAKSRQMGELLGEIAALSDQIAVVDGSDART
PSFLIRRAGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQELIEQVQALDGDYAFE
TYFSLSCQNCPDVVQALNLMAVLNPRISHVAIDGALFQDEVADRKVMAVPTVFLNGEPFG
QGRMELEQIVAKLDAGSGARVAAKIAGKDAFDVLVVGGGPAGAAAAIYAARKGIRTGLLA
ERFGGQVLDTMGIENFPSVPYTEGPKLVAQMESHVRDYDVDLMTLQRAVTLVPASEEGGL
HEVRLENGAALKARTVILSTGARWRTMNVPGEEAYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEYDGALRADAVLQRKLASLGNVRVITNALTTEVHGDGE
RVNGLTYEDRNEGTLHRVELEGVFVQIGLVPNTEWLTDAVALTPRGEIEVDHRGATSRAG
IFAAGDATTTPFKQIVVASGEGSRAALAAFDYLIRLAPVEAKALAAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctgacgcaacagctcaagggctatctggtcaatatccgccagccg
atcgagctggtcgccagcctgggcgaggacgcgaagtcgcgccagatgggcgaactgctg
ggcgagatcgcagcactgtccgaccagatcgccgtcgtcgacggttccgatgcgcgcacg
cccagcttcctgatccgccgcgccggcacggatatcggcgtgcgcttcgccgggctgccg
atggggcatgaattcaccagcctggtgctcgcgctgctccaggtcggcggccatccgtcg
aaggcggcgcaggagctgatcgaacaggtgcaagcgctggacggcgactatgcgttcgaa
acctatttctcgctgtcgtgccagaattgcccggacgtggtgcaggcgctcaacctgatg
gcggtgctcaacccgcggatcagccacgtcgcgatcgacggcgcgctattccaggacgag
gtggcggatcgcaaggtgatggcggtgccgacggtgtttctgaacggcgagccgttcggc
cagggccggatggagctcgaacagatcgtcgcgaagctcgacgcgggcagcggcgcgcgc
gtcgcggcgaagatcgcgggcaaggacgcgttcgacgtgctcgtcgtcggcggtggcccg
gcaggcgcggcggcggcgatctatgccgcgcgcaagggcatccgcaccggcctgctcgcc
gaacggttcggcggccaggtgctcgacacgatggggatcgagaattttccgtcggttcct
tacaccgaagggccgaagctggtcgcgcagatggaaagccacgtccgcgattacgacgtc
gacctgatgacactgcagcgggccgtgacgctggtgccggcgagcgaagagggcggtctg
cacgaggtgcggctggagaatggcgcggcgttgaaggcgcgcaccgtgatcctgtcgacc
ggcgcgcgctggcggacgatgaacgtgccgggcgaggaggcctatcgcaacaagggcgtc
gcctattgcccgcattgcgacgggccgctgttcaagggcaagcgcgtcgcggtgatcggc
ggcggcaattcaggggtcgaggcggcgatcgatctcgccggcatcgtcgcgcacgtcacg
ctgatcgaatatgacggtgcgctgcgcgccgatgcggtgctgcaacgcaagctcgccagc
ctcggcaacgtgcgcgtcatcaccaatgcgctgaccaccgaagtgcacggcgacggcgag
cgggtgaacggcctgacctacgaggatcgcaacgagggcacgctgcaccgcgtcgagctg
gagggcgtgttcgtgcagatcgggctggtgcccaacaccgaatggctgacggatgcggtc
gcgctaaccccgcgcggggagatcgaagtcgaccaccgcggcgcgacgtcgcgcgcgggc
atcttcgccgcgggggatgcgacgacgacgccgttcaagcagatcgtcgtcgcgagcggc
gaaggctcgcgcgccgcactcgccgcgttcgattacctgatccgcctcgctcccgtcgaa
gcgaaagcgctcgccgccgcgtaa

DBGET integrated database retrieval system