KEGG   Sphingomonas sp. FARSPH: DM480_13980Help
Entry
DM480_13980       CDS       T05685                                 

Definition
(GenBank) MFS transporter
Organism
sphf  Sphingomonas sp. FARSPH
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_3 MFS_1 DUF2964 DUF2721
Motif
Other DBs
NCBI-ProteinID: AXJ96429
UniProt: A0A345WRX7
LinkDB All DBs
Position
complement(2951302..2952654)
Genome map
AA seq 450 aa AA seqDB search
MSKPTHPFRIANFRSYWLSRFSGTIAVSAMSIVIGWQVYNLARETMDVRQAAFMLGMIGF
AQFVPLFLLTPVTGLVADSVDRRWIVRGTTALLVITAASLWLLTATGHLTLAALFTAAVA
FGVARAFSGPAYSALAPNLVPRESLPTAIAVSSIAWQVGTIAGPSVGGLLYAIHPEVAYG
VATILFAIALLFIFLIGPVPQPPAQSDHRPLARIVEGFSYVRRNRLVQAAITLDLFAVLL
AGATSLLPVYARDILHVGSQGLGLLAAGMGIGAATTAVWFSLRPMTTNVGVKMLVAVVVF
GLSILTFGIASHITGALGLEARTLTFGGTAILVHPAFLLSLAALICAGGADMVSVYVRQS
LIQLHTPDAMRGRVSAVSQLTISASNELGEFESGVMASVLGPVGAVVFGGLGAIGVTLLW
SRLFPELRRARTFDPPEHPTTDTSHGDDKP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgacgcacccgttccgcatcgccaatttccgcagctattggctgtcccgg
ttcagcggcacgatcgccgtctcggcgatgtcgatcgtcatcggctggcaggtgtacaac
ctagcccgagagacgatggacgtgcggcaggcggcgttcatgctggggatgatcggcttc
gcgcagttcgtgccgctgttcctgctgacccccgtcacggggctggtcgcggacagcgtc
gaccggcgctggatcgtgcgcgggacgacggcgttgcttgtcataacggccgcctcgctt
tggctgctcaccgcgaccggccacctgacgctggccgcgctgttcaccgccgcggtcgcg
ttcggcgtcgcgcgcgccttttcgggcccggcctattctgcgctcgcgcccaatctggtg
ccgcgcgagagcctgccgacggcgatcgcggtcagctcgatcgcgtggcaggtcggcacg
atcgcgggcccgagcgtcggcggcctgctctacgccatccatcccgaggtcgcctatggc
gtcgcgacgatcctgttcgcgatcgcattgctctttatcttcctgatcggcccggtgccg
cagccgcccgcgcaaagcgaccatcgtccgcttgcccggatcgtcgagggtttcagctac
gtgcgacgcaaccggctggtgcaggcagcgatcacgcttgatctgttcgcggtactgctc
gcgggcgcaacctcgctgctgcccgtctatgcgcgcgacatcctgcacgtcgggtcgcag
gggctgggcctgctcgcggctggcatggggatcggcgcggcgacgactgcggtctggttc
tccttacggccgatgacgaccaacgtcggcgtcaagatgctggtcgcggtggtcgtcttc
ggcctgtcgatactgacgttcggcatcgccagccacatcaccggcgcgctcggccttgag
gcgcgcacgctcacattcggcggcaccgcgatcctcgtccacccggccttcctgctcagc
ctcgccgcactgatctgcgccggcggcgcggacatggtgtcggtctatgtccgccagtcg
ctgatccagctgcatacgcccgatgcgatgcgcggccgggtgagcgcggtgtcgcagctc
accatttcggcgtccaacgagcttggcgagttcgaaagcggggtgatggcctcggtgctc
ggcccggtcggcgcggtcgtattcggcggactgggcgcgatcggcgtcacgctgctatgg
tcgcggctgttcccggaactccggcgggcgcgaacctttgatcctcccgaacatccgacg
acagacaccagccacggagacgacaagccatga

DBGET integrated database retrieval system