KEGG   Sphingomonas sp. FARSPH: DM480_15590Help
Entry
DM480_15590       CDS       T05685                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
sphf  Sphingomonas sp. FARSPH
Pathway
sphf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphf01100  Metabolic pathways
sphf01110  Biosynthesis of secondary metabolites
sphf01130  Biosynthesis of antibiotics
sphf01230  Biosynthesis of amino acids
sphf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sphf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DM480_15590
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    DM480_15590
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DM480_15590
Enzymes [BR:sphf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     DM480_15590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AXJ97171
UniProt: A0A345WU19
LinkDB All DBs
Position
3300796..3301383
Genome map
AA seq 195 aa AA seqDB search
MILVVDNYDSFTWNLVHYLMELGAKVEVVRNDAISAGQALSSGAEAFLISPGPCTPNEAG
VSLDLVAAAADAGRPLLGVCLGHQAIGQHFGGRVERGGLMHGKTSPVHHDGTGLFEGLPS
PVTATRYHSLIVNDVPAPLIVNARADDGNVMGFRHESLPIHGVQFHPESIATEHGHAMLA
NFLRAAGIAVKAGAA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcgtcgacaattatgacagcttcacctggaatctcgtccattacctgatg
gagcttggcgcgaaggtggaggtcgtgcgcaacgatgcgatctcagccggccaagcgctg
tcgtcgggagcggaagcgttcctgatctcgcccggcccgtgcaccccgaacgaggcgggc
gtcagcctcgacctcgtcgccgccgctgccgacgcggggcggcccctgctcggcgtatgc
ctggggcatcaggcgatcggccagcatttcggcggccgggtcgagcgcggcgggctgatg
cacggcaagacctcccccgtgcatcacgacggcaccggcctgttcgagggcctgccctcg
cccgtcaccgcgacacgctatcacagcctgatcgtcaacgacgtgcccgcgccgctgatc
gtcaacgcacgcgccgacgacggcaacgtcatgggcttccgccacgaaagcctgccgatc
cacggcgtccagttccatcccgaaagcatcgcgaccgagcacggccatgcgatgctcgcc
aatttcctgcgtgccgcgggcatcgccgtgaaggcgggcgcggcgtga

DBGET integrated database retrieval system