KEGG   Sphingorhabdus sp. M41: AZE99_02585Help
Entry
AZE99_02585       CDS       T04317                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
sphg00620  Pyruvate metabolism
sphg00680  Methane metabolism
sphg01100  Metabolic pathways
sphg01120  Microbial metabolism in diverse environments
sphg01200  Carbon metabolism
Module
sphg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZE99_02585
  09102 Energy metabolism
   00680 Methane metabolism
    AZE99_02585
Enzymes [BR:sphg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZE99_02585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMO73189
UniProt: A0A127MIV8
LinkDB All DBs
Position
complement(519433..522120)
Genome map
AA seq 895 aa AA seqDB search
MTQSLTVSQNPDIKYLGKLLGDVIRSYGGEDLYRRTEYIRSTSVDRHRGLADADAIDPGL
DALSLDETLAFVRGFMLFSLLANLAEDRQGVAAEKGATVVEAIELLASEGVDREAILELL
DDALIAPVLTAHPTEVRRKSIIDHKSRIAELLLMKDAGEEETPQGDMLDDAIMRQIALLW
QTRPLRRERLFVTDEVQISQSYMKDVFLPVLPRLYGKWERTLGARLPSFLKLNSWIGGDR
DGNPFVDAGAMEEALSRAAETVIGYYLMCVHTLGAELSISTELAEVPDAVLELAEASGDD
ALSRKDEPYRRALSGIYARLSATHLKLCGHVPGRASTITAQAYDNPQQLREELAILGQGL
KTAGKGVFATSGALGRLIRTVELFGFHLATLDMRQNSRVHERVVAELLKQAGVEPDYLAL
DEAARVKRLRKELANNRPLASPWIAYSEETAKELSIIRAAAEAHRKYGPEVITNYNISNG
ESVSDILEVYVLLMETGLYHAPTEDNASPSCPVMAVPLFETVADLENAPEVMTDFFALPE
MHALAKGRGHQEVMIGYSDSNKDGGYLTSTWSLFKASDALTPIFAEAGIKMQLFHGRGGA
VGRGGGSAFGAIKAQPKGTVAGRIRITEQGEVIAAKYGTEDVAEANLEAMTSAVLINSLE
PDRTDSKVLADHADAMDQISQVAFTEYRDLVYGDDSFRTFFRQMTPLTEIAKLKIGSRPA
SRTKSDKIEDLRAIPWVFSWAQARVMLPGWYGVGQALAGFEDKAKLKDMAQSWPFFQASL
SNMEMVLAKSDMGIAARYAGLVEDQDMGQAYFGRIRSSWYQTRDILLEITDQPHLLAKSP
ALFNSIELRLPYIEPLNHLQIELMKRLRGGEDDPRIGEGIQLSLNAIATALRNSG
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgacccaatccctcaccgtaagccaaaatccagacatcaaatatctcggcaaattgctg
ggcgatgtcattcgttcctatggcggagaggatctatacaggcgcaccgaatatatccgg
tccaccagcgtcgatcgccatcgcggtctggccgatgcggatgcgattgatcccggcctg
gatgcgctatcgctcgacgaaacactcgccttcgtgcgcgggttcatgctgttttccctg
ctcgccaatcttgccgaggatcgccagggtgtggcagcagaaaaaggcgccacggtggtc
gaggctatcgagttgctcgccagcgaaggagttgatcgtgaagcgattctggaactgctc
gacgacgcattgattgcgccggttctgaccgctcaccccaccgaggtccggcgcaagagc
atcatcgatcacaaatcccggatcgccgaacttttgctgatgaaagatgccggagaggag
gaaacgccgcaaggcgacatgctcgacgacgcaatcatgcgccagatcgccctgctgtgg
cagactcgtccgctgcgccgcgagcgcctgttcgtcaccgacgaagtccagatttcgcaa
agctatatgaaggacgtattcctgcccgtcctgccgcggctatatggcaaatgggaacgg
accttgggtgcgcggctgccaagcttcctcaaactcaacagctggattggcggcgatcgc
gacggtaatccctttgtcgacgcgggcgcgatggaggaagccctgtcgcgcgcggcggaa
accgtcatcggctattatctgatgtgcgttcacaccctcggcgcggaactgtctatctca
accgaactggccgaagtacccgatgctgtgctggaactcgccgaagcaagcggtgatgat
gcactgagccgcaaggacgaaccctatcgccgcgccttgtccggcatctatgccagatta
tcggcaacccatctcaagctttgtggtcatgtacccggtcgcgcatcgaccattacagcc
caggcttacgacaacccgcagcagttgcgcgaggaactggcaatattggggcaaggcctc
aagaccgccggcaagggcgtcttcgcaacctcgggcgctttggggcggctgatccgcacc
gtcgaattgtttggattccaccttgcgaccctcgacatgcgtcagaacagccgggtgcat
gaacgggtggtcgccgaactgctcaaacaagcaggagttgaaccggactatctggcattg
gacgaagcggcccgggtaaagcggctgcggaaggaactggccaacaaccgcccactggcc
agcccatggatcgcctatagcgaagaaaccgcaaaagaattgtcgatcatccgcgccgct
gccgaagcgcatcgcaaatatggccccgaagtcatcaccaattataatatcagcaatgga
gagagcgtctccgatatattggaagtctatgtcctgttgatggaaacgggcctctatcac
gcgccgaccgaggacaatgcatcgccgtcctgcccggtcatggccgtgcctttgttcgag
acggtcgccgatctcgaaaatgcgcctgaagtgatgaccgattttttcgcccttcccgaa
atgcacgctctggcaaagggccgcggccatcaggaagtgatgatcggctattccgacagc
aacaaggacggcggctatctgacctcgacctggagcctgttcaaggcgagcgatgccctg
actccgatatttgccgaagccggcataaaaatgcagcttttccacggacgcggcggcgcc
gtggggcgcggaggcggctcggccttcggcgcaatcaaggcgcagcccaagggcacggtt
gccggccgcatccggatcaccgaacagggcgaggtgatcgccgcgaaatatggcacggag
gatgtcgcggaagccaatctggaagcgatgacctcggcggtgctgatcaactcgctggag
cccgaccggaccgacagcaaggtgctggccgaccatgccgatgcaatggaccaaatctcg
caggttgcattcaccgaatatcgcgatctggtctatggcgacgacagcttccggaccttc
ttccggcagatgactccgctgaccgaaatcgccaaactgaagataggctcgcgtcccgcc
agccggacgaaaagcgacaagatcgaggatttgcgcgccattccctgggtgttcagctgg
gcacaggcgcgggtgatgctgccgggctggtatggcgtcggacaggcgcttgctggtttt
gaggacaaggcgaagctgaaagatatggcgcagagctggccgttttttcaggcttcgctc
tccaatatggaaatggtgctggccaagtccgacatgggcatcgccgcccgctatgccgga
ctggtggaggatcaggacatgggtcaggcctatttcggtcgcatccgttcgagctggtac
cagacccgcgacatattgctggaaatcaccgaccagccgcatctgctggcaaaaagcccg
gcgctgttcaacagcatcgagttgcgcctgccctatatcgagccgctcaaccatctccag
atcgagcttatgaaacgcctgcgcggcggcgaagatgacccgcgcatcggcgaaggtatt
cagttgtcgctcaacgccatagcgaccgcgctgcgcaacagcggctga

DBGET integrated database retrieval system