KEGG   Sphingorhabdus sp. M41: AZE99_03590Help
Entry
AZE99_03590       CDS       T04317                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphg  Sphingorhabdus sp. M41
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZE99_03590
Enzymes [BR:sphg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AZE99_03590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 K_oxygenase Thi4 AlaDh_PNT_C Glutaredoxin NAD_binding_9 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AMO71064
UniProt: A0A127MCT3
LinkDB All DBs
Position
complement(735845..737410)
Genome map
AA seq 521 aa AA seqDB search
MPIIDQSTADQLKAYLVNLRRPIRLVATLDDSAKSAEMKELVETIAPMSDLVEVDLNGTS
KRVPSFLVSADDGKSEVEFAGLPLGHEFSSLILALLHVGGHPPKEDDELLESVASLEGEY
HFETFFSLSCQNCPDVIQALNIMAARNPNVSHVAIDGALFQDEVEERKVMAVPTVFLNGE
PFGSGRMNLAEIMAKVDTGSAEKAASKLSAKDPYDVLVVGGGPAGAAAAIYTARKGIRTA
IIAEQFGGQLMDTMGIENFISVPYTEGPKLTAELQRHVNEYDLEVFSQQRVADLARPAKD
GDLFALTTESGGSLKAKAVILATGARWKTIGVPGEAEYRNKGVAYCPHCDGPLYKGKRVA
VIGGGNSGVEAAIDLAGIVSHVTLIEFDSAMRADAVLQKKMNSLPNVTAIVSAQTTEITG
DGEKVTGLRYKDRNSDEEHDVALEGVFVQIGLMPNSEWLGDVVKRSPYGEIEIDHRCETS
VPGIFAAGDVTTVPYKQIVISMGEGSKAALSAFDYLIRADG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatcgatcaatccaccgccgatcagctgaaagcctatctggtcaatctgcgc
cgcccgatccggctggtagccacgctggacgacagcgcaaaatcggccgagatgaaagaa
ctggtcgagacgatcgccccgatgtccgatctcgtggaagtcgatctcaacgggacatca
aagcgtgtgccatctttcctggtttctgcggacgatggcaaatcggaagtcgaatttgcc
ggtctgccgctggggcatgaattttcttccctgattctcgccctgctccatgtcggcggc
catccgccaaaggaggatgacgagctgctcgaaagcgtcgcatcgctggaaggcgaatat
catttcgagacgtttttctcgctctcctgccagaattgcccagacgtcattcaggcgctc
aatatcatggcggcccgcaaccccaatgtcagccatgtcgcaatcgacggcgcgctgttt
caggatgaggttgaagagcgaaaggtcatggcggtgccaaccgtctttctgaacggcgag
ccctttggttccggccggatgaatctggccgaaatcatggccaaggtcgataccggcagc
gctgaaaaggcggccagcaaactgtcggcaaaagacccctatgacgtgctggtggtcggc
ggcggccccgccggcgcagcggcggcgatttataccgcacgcaagggaatccgcaccgcc
atcatcgccgaacagttcggcggtcagttgatggatacgatgggaatcgagaatttcatt
tccgtgccctataccgaggggcccaagctcaccgcggaattgcagcggcatgtgaacgaa
tatgatctggaagtgttcagccagcagcgcgtcgcggatctggcgcgcccggccaaggac
ggcgatctgtttgcgctcacgaccgagagcggcgggtcgctgaaggcgaaagcggtcatt
ctggcaaccggcgcgcgctggaaaaccatcggcgtgcccggcgaagcggaatatcgcaac
aagggtgtcgcctattgcccgcattgcgacggcccgctttacaaaggcaagcgcgtcgcg
gttatcggcggtggcaattccggcgttgaagcggcgatcgacctggctggcattgtcagc
catgtcaccctgatcgagtttgacagcgcgatgcgcgccgatgccgtgctgcagaagaaa
atgaacagcctgccaaatgtcaccgccattgtttcggcacaaacgactgaaattactggc
gacggcgagaaggtcaccggcctgcgctacaaggatcgcaacagcgatgaggagcatgat
gtcgcgctggaaggtgtattcgtccagattggcctgatgccgaacagcgaatggctcggc
gatgtggtcaagcgatccccttatggcgagatcgagatcgaccatcgctgtgaaacgtct
gttccgggcatttttgcggcgggcgacgttaccacggtgccatataagcagattgtcatt
tcgatgggtgaagggtcgaaagccgcgttgtccgcctttgactatctcatccgggcggat
ggctag

DBGET integrated database retrieval system