KEGG   Sphingorhabdus sp. M41: AZE99_09700Help
Entry
AZE99_09700       CDS       T04317                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
sphg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZE99_09700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphg02000]
    AZE99_09700
Enzymes [BR:sphg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AZE99_09700
Transporters [BR:sphg02000]
 Other Transporters
  Pores ion channels [TC:1]
   AZE99_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMO72082
UniProt: A0A127MFM0
LinkDB All DBs
Position
2038097..2038711
Genome map
AA seq 204 aa AA seqDB search
MTLKFYTNPMSRGQIARWALHEAGTDYEQILLEYGTSMKADAYLKVNPMGKVPAIDHDGR
IVTEGAAICAYLAEAFPDAGLAPTATERADYYRWLFFAAGPVEAAITNRSLGFEVAQDKE
MMAGYGNYDRVVDVLDGKLQTDDYVCGSRFTMADVYFGAQLVWGTQFGTLPKRDSFVAYA
KRLIERDAYKAAKAIDDALIAENG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaaattctacaccaacccgatgtcgcgcggccagatcgcacgctgggcgctg
cacgaagcgggtacagactatgagcagatattgctcgaatatggcacgtcgatgaaggct
gacgcctatctgaaggtcaatccgatgggcaaggtgccggcgattgatcatgacggccgg
atcgtgaccgaaggcgcggcgatctgcgcctatctggcggaagcctttccggatgcgggg
ctcgcgccaacagcgacggaacgggcggattattatcgttggctattctttgcagcgggt
ccggtcgaggcggcgataaccaaccggtcgctcggttttgaagtcgctcaggacaaggaa
atgatggccggttatggcaattatgaccgggttgtcgatgtgctggatggcaagctccag
acggatgactatgtctgcggttcgcgctttaccatggccgatgtctatttcggcgcgcag
ctggtgtggggcacgcaatttggcaccctgcccaagcgggatagctttgtcgcttacgcc
aagcggctgatcgagcgcgacgcctataaagctgcaaaagcaattgatgacgcgctgatc
gccgagaacggctag

DBGET integrated database retrieval system