KEGG   Sphingorhabdus sp. M41: AZE99_10220Help
Entry
AZE99_10220       CDS       T04317                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sphg  Sphingorhabdus sp. M41
Pathway
sphg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphg01100  Metabolic pathways
sphg01110  Biosynthesis of secondary metabolites
sphg01130  Biosynthesis of antibiotics
sphg01230  Biosynthesis of amino acids
Module
sphg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sphg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZE99_10220
Enzymes [BR:sphg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AZE99_10220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK CoaE AAA_22 AAA_17 AAA_16 AAA Cytidylate_kin TsaE AAA_5 SRP54 AAA_28 MMR_HSR1 AAA_14
Motif
Other DBs
NCBI-ProteinID: AMO73371
UniProt: A0A127MJQ1
LinkDB All DBs
Position
2140174..2140683
Genome map
AA seq 169 aa AA seqDB search
MPDQSIVLVGLMGVGKTTVGRRLAKRLGLAFVDADEEIERAAGLTVEEIFNRFGEDYFRD
GERRVIARLIEGDRQVIATGGGAFMNEETRTVILEEAIAVWLDADLDTLVKRVSRRNTRP
LLKSGDPAKILADLAAVRNPVYATAPIHIMGNDSPHEITVEKIIEALQR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatcagtcgattgtgctggtcggcttgatgggcgtgggcaaaaccacggtcggc
cggcgattggcaaaacggctgggcctagcctttgtcgatgcggacgaagagattgagcgg
gcagcaggtctcactgtcgaagaaatcttcaatcgttttggcgaagactatttccgggat
ggggaacgacgtgtcattgcgcggctgatagaaggtgaccgtcaggtcatcgctacgggt
ggcggggcatttatgaatgaggagacccggacggtaattctggaagaggcaatcgctgtc
tggctggatgctgatctcgatacgttagtaaagcgggtctctcgacgcaacactaggccc
ctgctaaaatctggcgatccagcaaagattttggccgatctggctgccgtcagaaaccca
gtctacgccaccgcacctattcatataatgggcaatgactccccccatgagataaccgta
gaaaagataatcgaggcattgcaacgttga

DBGET integrated database retrieval system