KEGG   Sphingomonas sp. WHSC-8: TS85_10015Help
Entry
TS85_10015        CDS       T03848                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00473  D-Alanine metabolism
sphi00550  Peptidoglycan biosynthesis
sphi01100  Metabolic pathways
sphi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TS85_10015
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TS85_10015
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TS85_10015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphi01011]
    TS85_10015
Enzymes [BR:sphi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TS85_10015
Peptidoglycan biosynthesis and degradation proteins [BR:sphi01011]
 Precursor biosynthesis
  Amino acid ligase
   TS85_10015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ADH_N
Motif
Other DBs
NCBI-ProteinID: AJP72050
UniProt: A0A0C5KV27
LinkDB All DBs
Position
complement(2269325..2270239)
Genome map
AA seq 304 aa AA seqDB search
MTLHIAVLLGGWSAEREVSLMSGHDIVAALESLGHRVTAIDMGRDVAVKLTEAKPDLVFN
ALHGTPGEDGSVQGMLDLMGLRYTHSGMVTSVIAIDKQLTKQALVPHGIPMPGGRMVRTE
ELYERDPLPRPYVLKPVNEGSSVGVAIVTDQGNYGNPIARDAAGPWQEFDELLAEPFIRG
RELTTAVLGGEALGVTELKPKSGFYDYAAKYTDGLTDHICPADIPDDVADACKRIALDAH
RLLGCKGASRSDFRWDDSQGVEGLFLLEVNTQPGMTPLSLVPEQAKYLGIGYAELVQRIV
DEAL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctccacatcgccgtgctgctgggcggctggtccgcggagcgcgaggtttcgctg
atgtcggggcacgatatcgtcgccgcgctcgagagcctggggcatcgcgtgacggcgatc
gacatgggtcgcgacgtggcggtgaagctcaccgaggcgaagcccgatctggtgttcaac
gcgctgcacggcacgccgggcgaggatggcagcgtgcaggggatgctcgacctgatgggg
ctgcgctacacgcattccggcatggtcacgtcggtgatcgcgatcgacaagcagcttacc
aagcaggcgctggtgccgcatggcatcccgatgcccggcgggcggatggtgcggaccgag
gaattgtacgaacgcgatccgctgccgcgcccctatgtgctcaagcccgtcaacgaaggc
tcgtcggtcggcgtcgcgatcgtcaccgaccagggcaattacggcaacccgatcgcgcgc
gacgctgcggggccgtggcaggaattcgacgagctgctcgccgagccctttatccggggg
cgcgagctgacgacggcggtgctgggcggggaggcgctgggcgtcaccgagctgaagccc
aagagcggcttttacgactatgccgccaaatataccgacgggctgaccgaccatatctgc
cccgccgacatccccgacgatgtcgccgatgcgtgcaagcggatcgcgctggatgcgcac
cggctgctggggtgcaagggcgcgtcgcgttcggatttccgctgggacgacagccagggc
gtcgaggggctgttcctgctggaggtcaacacccagccgggcatgacgccgctcagcctc
gtccccgaacaggccaaatatctcggcatcggctatgccgaactcgtgcagcgcatcgtg
gacgaagcgctgtga

DBGET integrated database retrieval system