KEGG   Sphingomonas sp. WHSC-8: TS85_11800Help
Entry
TS85_11800        CDS       T03848                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00970  Aminoacyl-tRNA biosynthesis
sphi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TS85_11800 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sphi03029]
    TS85_11800 (gatB)
Enzymes [BR:sphi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TS85_11800 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TS85_11800 (gatB)
Mitochondrial biogenesis [BR:sphi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TS85_11800 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AJP72321
UniProt: A0A0C5L4X5
LinkDB All DBs
Position
complement(2669713..2671218)
Genome map
AA seq 501 aa AA seqDB search
MAEAPTYRIKGDTGDWEVVIGLEVHAQVTSNAKLFSGAATEFGAEPNSQVSLIDAAMPGM
LPTPNKECIRQAVRTGMAIGAVINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGRIEI
SLDEKDPEAFTKTIGVERIHVEQDAGKLMHDQHPSRSYVDLNRAGVALMEIVSRPDMASP
AEAGAYVKKLRSILRYVGSCDGNMEEGSMRADVNVSVRKPGDPLGTRTETKNVNSVRFVM
AAIEYEARRQVEVLESGGRIVQETRLFDPDKGETRSMRSKEDAHDYRYFPDPDLLPLELD
DAFLDACQASLPELPDAKRRRYEESLGLSAYNAAVLTAEAETARWFEALLAESVRVQAKG
EQEVARAAANWLISDLYGALNRLGKTVDESPVSPEQGAELLALAADGTLSGPLAKQVFEI
MLETGDAPAKIVEERGLKQTSDTGAIEAVIAEVMANNPKQLEQYRGGKEALFGFFVGQTM
KAMGGKANPAVVNELLKKALA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcacccacctaccgcatcaaaggcgacaccggcgactgggaggtcgtgatc
ggcctcgaagtccatgcccaggtcacgtccaacgccaagctcttttcgggcgccgcgacc
gaattcggcgcagagccgaacagccaggtgtcgctgatcgacgcggcgatgccggggatg
ctcccgacgccgaacaaggaatgcatccgccaggcggtgcgcaccggcatggcgatcggc
gcggtcatcaacaaatggtcgcggttcgatcgcaagaactatttctacgccgatctgccg
cagggctatcagatcagccagctctaccacccgatcgtgggcgaggggcggatcgagatc
agcctggacgagaaggaccccgaggcctttaccaagacgatcggcgtcgagcgcatccat
gtcgagcaggatgccggcaagctgatgcacgaccagcatcccagccgctcctatgtcgat
ctcaaccgcgccggcgtggcgctgatggaaatcgtcagccgccccgacatggcatcgcct
gcggaagccggggcgtatgtcaagaagctgcgctcaatcctgcgctatgtcggatcgtgc
gacggcaacatggaagaaggctcgatgcgcgccgacgtcaatgtcagcgtgcgcaagccc
ggcgacccgctgggcacgcggaccgagaccaagaacgtcaattcggtgcgcttcgtcatg
gccgcgatcgaatatgaggcgcgtcgccaggtcgaggtgctggaaagcggtggccggatc
gttcaggaaacgcggctgttcgatcccgacaagggcgagacgcggtctatgcggtcgaag
gaagacgcgcatgattatcgctacttccccgatcccgacctgttgccgctggagctggac
gacgcgtttctcgacgcgtgccaggcgagccttcccgaactgcccgacgccaagcgccgc
cggtatgaggaatcgctggggctgagcgcatacaacgccgccgtgctgaccgcggaggcg
gagacggcgcgctggttcgaggcgctgctggcggagagcgtgcgggtccaggcgaagggc
gagcaggaagtcgcgcgcgcggcggccaactggctgatttcggacctgtatggcgcgctc
aaccggctgggcaagacggtcgatgagagcccggtgagccccgaacagggcgccgaactg
ctggcgctggcggcggacggcacgctgtccggcccgctggccaagcaggtgttcgaaatc
atgctcgagaccggcgacgcccccgcgaagatcgtcgaggagcgcgggctcaagcagacc
agcgacaccggcgcgatcgaggcggtgatcgccgaagtgatggcgaacaaccccaagcag
ctagagcaatatcgcggcggcaaggaagcgctgttcggcttcttcgtcggccagacgatg
aaggcgatgggcggcaaggccaatcctgcggtggtcaacgaactgctgaagaaggcgctg
gcgtaa

DBGET integrated database retrieval system