KEGG   Sphingomonas hengshuiensis: TS85_14000Help
Entry
TS85_14000        CDS       T03848                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sphi  Sphingomonas hengshuiensis
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TS85_14000
Enzymes [BR:sphi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TS85_14000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored FAD_binding_3 HI0933_like AlaDh_PNT_C DAO NAD_binding_7 Glutaredoxin K_oxygenase Thi4 FMO-like NAD_binding_8 Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: AJP72651
LinkDB All DBs
Position
3178378..3179961
Genome map
AA seq 527 aa AA seqDB search
MLDATLTQQLKAYLVNIREPIELVASLGDDAKSRELGELLNEIAALSDKVSVVPAADDKR
RPSFMIRRTGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKAAQELIQQVKELDGDFEF
ETYFSLSCQNCPDVVQALNLMAVLNPRIRHTAIDGALFQDEVTSRKVMAVPTVFLNGEPF
GQGRMELEQIVAKIDSGAEAKAAAKIAQKDPFDVLIVGGGPAGAAAAIYTARKGIRTGIV
AERFGGQVLDTMGIENFISVSHTEGPKLAAHLEQHVKDYDVDIMNLQRAEKLIPARSEGG
LHEVVLANGARVKAKALILSTGARWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVKILTSAMTTRVNGDG
EKVSGLSYKDRNSGTEHDIELEGIFVQIGLVPNTEWLKDAIGLTPRGEIEIDARGETSQP
GIFAAGDATTVPYKQIVIAMGAGSTAALSAFDYLIRLPAEELVEAAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccactctgacgcagcagctcaaagcctatctcgtgaacatccgcgagccg
atcgagctcgtcgcctcgctgggcgacgatgccaagtcgcgcgagctgggcgaactgctg
aacgaaatcgccgcgctgtccgacaaggtcagcgtcgtccccgccgccgacgacaagcgc
cgccccagcttcatgatccgccgcaccggcaccgatatcggcgtgcgcttcgccggcatc
ccgatggggcatgagttcacctcgctggtgctcgcactgctccaggtcggcggtcacccg
tccaaggccgcgcaggagctgatccagcaggtcaaggaactggacggcgatttcgaattc
gaaacctatttctcgctgtcgtgccagaactgccccgacgtggtgcaggcgctgaacctg
atggcggtgctcaacccgcgcatccgccacactgcgatcgacggcgcgctgttccaggac
gaagtgaccagccgcaaggtgatggcggtacccaccgtgttcctcaacggcgaaccgttc
ggccagggccggatggagctggagcagatcgtcgcgaagatcgacagcggcgccgaagcc
aaggcggcggcaaagatcgcgcagaaggacccgttcgacgtgctgatcgtcggcggcggc
ccggcgggcgcggcggcggcaatctacaccgcgcgcaagggcatccgcaccggcatcgtc
gccgaacgcttcggtgggcaggtgctcgacacgatggggatcgagaatttcatctcggtc
agccacaccgaagggcccaagctcgccgcgcatctggagcagcacgtcaaggactatgac
gtcgacatcatgaacctccagcgcgccgaaaagctgatcccggcgcggagcgaaggcggg
ctgcacgaagtcgtgctggccaacggtgcgcgggtgaaggccaaggcgctgatcctctcc
acgggtgcccgctggcgccagatgaacgtgcccggcgaggacgagtatcgcaacaagggc
gtggcatactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtcgcggtgatc
ggcggcggcaattcgggtgtcgaggctgcgatcgacctggcgggcatcgtcgcgcacgtc
acgctgatcgagtatgacagccagctccgcgccgacgcggtgctccagcgcaagctcgcc
agcctgcccaacgtcaagatcctcacctcggcgatgaccacccgcgtcaatggcgatggc
gagaaggtgtcggggctcagctacaaggaccgcaacagcggcaccgagcacgacatcgag
ttggaaggcatcttcgtccagatcgggctggtcccgaacaccgaatggctgaaagacgcc
atcggcctcaccccgcgcggcgaaatcgaaatcgacgcgcgcggcgagacgagccagccg
ggcatcttcgccgcgggcgacgcgaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgcaggctcgaccgcggcgctgtccgcattcgactacctgatccgcctgcccgctgag
gaactggtcgaagcggcggcgtga

DBGET integrated database retrieval system