KEGG   Sphingomonas sp. WHSC-8: TS85_15950Help
Entry
TS85_15950        CDS       T03848                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TS85_15950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphi02000]
    TS85_15950
Enzymes [BR:sphi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TS85_15950
Transporters [BR:sphi02000]
 Other Transporters
  Pores ion channels [TC:1]
   TS85_15950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_N_4 GluRS_N
Motif
Other DBs
NCBI-ProteinID: AJP72966
UniProt: A0A0C5L6N8
LinkDB All DBs
Position
complement(3549015..3549635)
Genome map
AA seq 206 aa AA seqDB search
MSDELILYTNPQSRGRIARWMLEETGAAYRTEIVDYGTTMKGQDYLEINPMGKVPAIVHG
GKVVTECAAICAYLAEAFPEAGLAPLPHERADYYRWLFFAAGPLEQATTNQFAKFEPSPE
QGRMFGYGNYALAVDVLEKAVSAHPYIAGDRFTAADVYVGSSVGWGVMFDWLPKRDVFVD
YFARVSGRDAYVRAGALDDAAMPVPA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgagctgatactttacaccaacccccagtcgcgcgggcggatcgcgcgctgg
atgctcgaagagacgggcgccgcctatcgcaccgagatcgtcgactatggcacgacgatg
aagggccaagactatctcgagatcaacccgatggggaaggtcccggcgatcgtccatggc
ggcaaggtggtgaccgaatgcgcggcgatctgcgcctatctggcggaggcgtttcccgag
gcggggctcgcgccgctgccgcatgagcgcgcggattattatcgctggctgttcttcgcc
gccgggccgttggaacaggcgacgacgaaccaatttgccaagttcgaaccgtcgcctgaa
cagggccggatgttcggttatggcaattatgcgctggccgtcgacgtgctcgaaaaggca
gtgtcggcgcacccctatatcgccggggaccgctttaccgccgccgatgtctatgtcgga
tcctcggtcggctggggggtgatgttcgactggttgcccaagcgcgacgtctttgtggat
tatttcgcgcgggtgagcgggcgggatgcctatgttcgtgcgggcgcgctcgacgatgcg
gcgatgcccgtgccagcatag

DBGET integrated database retrieval system