KEGG   Sphingomonas sp. WHSC-8: TS85_17800Help
Entry
TS85_17800        CDS       T03848                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00620  Pyruvate metabolism
sphi00680  Methane metabolism
sphi01100  Metabolic pathways
sphi01120  Microbial metabolism in diverse environments
sphi01200  Carbon metabolism
Module
sphi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TS85_17800
  09102 Energy metabolism
   00680 Methane metabolism
    TS85_17800
Enzymes [BR:sphi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TS85_17800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AJP73248
UniProt: A0A0C5L7S1
LinkDB All DBs
Position
complement(3935580..3938252)
Genome map
AA seq 890 aa AA seqDB search
MASLAITNNPDIRFLGRLLGDVIRAYGGEELFKRIEYIRATSVDRHRGVAGAGAIDSGLD
RLSLDDTLDFVRGFMLFSMLANLAEDRQGVATEQDADVPHALKRLKAQGIGEDAVMALLE
NALIVPVLTAHPTEVRRKSMIDHKNRIAELMALKDLGRDETEDGDKVEEAILRQIALLWQ
TRVLRREKLGVADEVETALSYLRDVFLPVLPALYARWDRALGERAPSFLRAGSWIGGDRD
GNPFVTADSMQLALARSAETVLVYYLESVHALGAELSISTEHTPISAGVLKLAEASHDTA
KSREDEPYRRALSGIYARLSATHQALTGKPAPRPAPISGAPYATPGEFREELAEIARGLV
AEGPGPLATGGALGRLIRAVETFGFHLATLDMRQNSAVHERVVAELLKAAGVADDYLALD
EEARVALLRRELESPRLLTSPYAEYSEETASELAIVKAAAEAHRLYGRQCITHYIVSMAQ
SVSDLLEVHVLLKEAGLYVPGDKPSAAVMAIPLFETIGDLESAPAIMEAWLGLPEVAAIA
GERGHQEVMIGYSDSNKDGGYLTSTWQLSRGSTALKPVFEKADIAMQLFHGRGGAVGRGG
GSSFAAILAQPRGTVQGRIRITEQGEVIAAKYGTRESAMTNLEAMASATLIASLEPEKLA
PADAERFAAAMDTLSDTAFRAYRGLVYETEGFRTFFRQATPIAEIAGLKIGSRPASRKKS
DAIEDLRAIPWVFSWAQARIMLPGWYGVGAALEAFPDKGLLREMAAGWPFFASALANMEM
VLAKSDMAVAEYYAALVEDDALRTSIFGRIRDGWQATHDGLLTVTRQTRLLEKHPGLETS
IRLRLPYIEPLNLLQIELLKRHRAGEEDARIGEGILLSINAIATALRNSG
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcttgcgatcaccaacaatcccgacatccgcttcctggggcgcctgctcggc
gacgtcatccgcgcctatggcggggaggaattgttcaagcggatcgaatatatccgcgcg
acctcggtcgaccggcatcgcggcgttgccggcgccggggcgatcgattcggggctcgac
cggctctcgctcgacgacacgctcgatttcgtccgcggcttcatgctgttttcgatgctc
gcgaaccttgccgaggatcgccagggcgtcgccaccgagcaggatgccgatgtgccccac
gcgctcaagcggctcaaggcgcaggggatcggcgaggacgcagtgatggcgctgctcgaa
aacgcgctgatcgtgccggtgctgaccgcgcatcccaccgaagttcgccgcaagtcgatg
atcgaccacaagaaccgcatcgccgaactaatggcgctgaaggatctgggccgcgacgag
accgaggatggcgacaaggtcgaggaagcgatcctgcgccagatcgcgctgttgtggcag
acgcgcgtgctgcggcgcgagaagctgggcgtggcggacgaagtcgagaccgcgctgtcc
tatctgcgcgacgtgttcctccccgtgctcccggcgctctatgcccgatgggaccgggca
ctgggcgagcgcgcacccagtttcctgcgggccggaagctggatcggcggcgaccgcgac
ggcaatcccttcgtcaccgccgattcgatgcagctcgcgctcgcgcgctcggcggagacg
gtgctcgtctattatctcgagtcggtccatgcgctgggggcggaactctcgatctcgacc
gagcatacccccatcagcgccggggtgctcaagctggccgaggcgagccacgacaccgcg
aagagccgcgaggacgagccctatcgacgggcgctttcgggcatctatgcgcgactgtcg
gcgacgcatcaggcgctgaccggcaagcccgcgccgcgccccgcgccgatctcgggtgca
ccctatgcgacgccgggcgagttccgcgaggaactggcggagatcgcgcgcgggctcgtc
gccgaggggccggggccactggcaaccggcggcgcgctggggcggctgatccgcgcggtc
gagacgttcggcttccacctcgcgacgctcgacatgcgccagaacagcgcggtgcatgag
cgcgtggtggccgaactgctcaaggccgccggggtcgccgacgattatctggcgctggac
gaggaggcccgcgtcgcactgctccgccgcgagttggagagcccgcggctgctgaccagc
ccctatgccgaatattcggaggaaaccgcctccgaactcgcgatcgtcaaggccgccgca
gaggcgcaccggctatatgggcggcagtgcatcacccattatatcgtgtcgatggcgcaa
tcggtgtcggacctgctcgaggtccatgtcctgctgaaggaagccgggctgtacgtccct
ggcgacaagcccagcgccgccgtcatggcgatcccgctgttcgagacgatcggcgacctc
gaaagcgcgccggcgatcatggaggcgtggctcgggctgcccgaagtcgccgcgatcgcc
ggcgagcgcgggcatcaggaagtgatgatcggctattccgattcgaacaaggacggcggc
tacctcacctcgacctggcagctttcgcgcggatcgaccgcgctaaagcccgtgttcgag
aaggcggacatcgcgatgcagctcttccacgggcgcggcggcgcggtggggcgcgggggc
ggttcgtcgttcgccgcgattctggcccagccgcgcggcaccgtgcagggccgcatccgc
atcaccgaacagggcgaagtgatcgccgccaaatatggcacccgcgaaagcgcgatgacc
aatttggaggcgatggcctccgccacgctgatcgccagcctggagcccgaaaagctcgcc
cccgccgatgcggagcgcttcgcggcggcgatggacacgctgtcggacacggcgttccgc
gcctatcgcgggctggtgtacgagaccgaggggttccgcacctttttccgccaggcgacg
ccgatcgccgagattgccggcctcaagatcgggtcgcgccccgccagccgcaagaaatcg
gacgcgatcgaggatctgcgcgcgattccctgggtgttcagctgggcgcaggcgcggatc
atgctgccgggctggtacggcgtcggcgccgcgctggaggcgttccccgacaaggggctg
ctgcgcgagatggcggcgggctggcccttcttcgcctcggcgctggcgaacatggagatg
gtgctcgccaagtcggacatggccgtcgccgaatattatgccgcgctggtcgaggacgat
gcgctgcgaacctcgatcttcggtcgcatccgcgacgggtggcaggcgacgcatgacggg
ctgctgacggtaacgcgccagacgcggctgctggaaaagcatccggggctggaaacgtcg
atccggctgcggctgccctatatcgagccgctcaacctgctccagatcgagctgctcaag
cgccatcgtgcgggcgaggaggatgcccggatcggcgagggcatcttgctgtcgatcaac
gcgatcgccactgcactgcgcaacagcggctaa

DBGET integrated database retrieval system