KEGG   Sphingomonas hengshuiensis: TS85_18615Help
Entry
TS85_18615        CDS       T03848                                 

Definition
(GenBank) nitrite reductase
  KO
K00363  nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Organism
sphi  Sphingomonas hengshuiensis
Pathway
sphi00910  Nitrogen metabolism
sphi01100  Metabolic pathways
sphi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    TS85_18615
Enzymes [BR:sphi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     TS85_18615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Rieske_2
Motif
Other DBs
NCBI-ProteinID: AJP73377
UniProt: A0A0C5L6C0
LinkDB All DBs
Position
complement(4116491..4116829)
Genome map
AA seq 112 aa AA seqDB search
MTADWLDIGWLDQIPVRGSRTVPVTGGDEIAVFRTGDNQVFALVNRCPHKGGPLSQGIVH
GHSVACPLHNWSIALATGTAQGADKGCTPTVPVKVVSGRVLLCRASALRAAA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggactggctcgatatcggctggctcgaccagatcccggtgcgcggatcgcgt
accgttcccgtcaccgggggcgacgagatcgcggtgttccgcaccggcgacaaccaggtg
ttcgccttggtcaatcgctgcccgcacaagggcgggccgctgagccaggggatcgtccat
ggccatagcgtcgcgtgcccgctgcacaattggagcatcgcgctcgccaccggcactgcg
cagggcgcggacaagggctgtacgccgacggtgccggtgaaggtggtgagcgggcgcgtg
ctgctctgccgcgcctcggcattgcgggcggcggcgtga

DBGET integrated database retrieval system