KEGG   Sphingomonas sp. WHSC-8: TS85_21510Help
Entry
TS85_21510        CDS       T03848                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00020  Citrate cycle (TCA cycle)
sphi00190  Oxidative phosphorylation
sphi00650  Butanoate metabolism
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
sphi01120  Microbial metabolism in diverse environments
sphi01130  Biosynthesis of antibiotics
sphi01200  Carbon metabolism
Module
sphi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sphi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sphi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TS85_21510
   00650 Butanoate metabolism
    TS85_21510
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TS85_21510
Enzymes [BR:sphi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TS85_21510
    1.3.5.4  fumarate reductase (quinol)
     TS85_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO DUF917 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJP73821
UniProt: A0A0C5L9B6
LinkDB All DBs
Position
complement(4706521..4708323)
Genome map
AA seq 600 aa AA seqDB search
MPTAYKIIDHTYDAVVVGAGGSGLRATMGCAEAGLKTACITKVFPTRSHTVAAQGGIAAS
LGNNTPDHWSWHMFDTVKGSDWLGDQDAIEYMVREAPQAVYELEHAGVPFSRNENGTIYQ
RPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFYVEYFALDLIMENGE
CRGVIALCMEDGSIHRFRSHAVVLATGGGGRVYQSATSAHTCTGDGNGMALRAGIALQDM
EFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVARSMAME
IREGRGVGKEKDHIFLHLNHIDPKILHERLPGITETGKIFAGVDLTRQPLPVVPTVHYNM
GGVPTNYHGEVVHNKDGDPDSIVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGRATGL
RLKELIKPGTAHKALPAGSEDYALARLDHFRHASGGTPTAKIRAEMQKTMQRHCAVFRDS
ALLSEGVTEMDRIYAGFQDVGVTDRSLIWNTDLIETLELDNLIGQAVVTIRSAENRKESR
GAHMHEDFPNRDDANWMKHTVTSFDGWGGKSGTTAIEYRPVHDYTLTDEIEYIKPKKRVY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgcctataagatcatcgatcacacctatgacgccgtcgtcgtcggcgccggc
ggctcgggcctgcgcgccacgatgggctgtgccgaggcgggtctgaagaccgcgtgcatc
accaaggtgttcccgacgcgcagccacaccgtggcggcacagggcggcatcgccgcgtcg
ctgggcaacaacacgccggatcactggtcgtggcacatgttcgataccgtcaagggatcg
gactggctcggcgaccaggacgcgatcgaatatatggtccgcgaagcgccgcaggcggtg
tacgagctcgaacatgccggcgtgcccttcagccgcaacgagaacggcacgatctaccag
cgcccgttcggcggccatatgcagaatatgggcgaaggcccccccgtgcagcgcacctgc
gccgcggcggaccgcaccggccacgcgatgctccacgcgctgtaccagcagagcctgaag
tacgacgccgatttctacgtcgaatatttcgcactcgacctgatcatggagaacggcgag
tgccggggcgtgatcgccctgtgcatggaagacggctcgatccaccgcttccgcagccat
gccgtggtgctcgccaccggcggcggcgggcgcgtctaccagtcggcgacctcggcgcac
acctgcaccggcgacggcaacggcatggcgctgcgcgcagggatcgcgctccaggacatg
gagttcgtccagttccacccgaccggcatctatggcgcgggcgtgctgatcaccgagggt
gcgcgcggtgagggcggctatctgaccaacagcgagggcgagcgcttcatggagcgctat
gcccccagcgcgaaggaccttgccagccgcgacgtcgtcgcgcgctcgatggcgatggaa
atccgcgagggccgcggcgtcggcaaggagaaggatcatatcttcctccacctcaaccat
atcgacccgaagatcctgcacgagcggctacccggcatcaccgaaaccggcaagatcttc
gccggcgtcgacctgacccgccagccgctgccggtggtcccgaccgtccattataatatg
ggcggcgtgccgaccaattatcacggcgaagtcgtccacaacaaggatggcgaccccgac
agcatcgtccccggcctgttcgcggtcggcgaggcggcctgcgtttcggtccacggcgcc
aaccgcctcggctcgaactcgctgatcgatctcgtcgtgttcggccgcgcgaccggcctg
cgcctcaaggaactgatcaagcccggcaccgcgcacaaggcgctgccggcgggttcggag
gactatgccctcgcccgcctcgatcatttccgccacgccagcggcggcaccccgaccgcg
aagatccgcgccgagatgcaaaagacgatgcagcgccactgcgccgtgttccgcgacagc
gcgctgctgagcgaaggcgtgaccgagatggaccgcatctatgccggtttccaggatgtc
ggcgtcaccgatcgctcgctgatctggaacaccgacctgatcgagacgctcgaactcgac
aatctgatcggccaggccgtcgtgacgatcaggagcgccgaaaaccgcaaggaaagccgc
ggcgcgcacatgcacgaggacttccccaaccgcgacgacgcaaactggatgaagcacacc
gtgacgagcttcgacggctggggcggcaagagcggcaccacggcgatcgagtatcgcccg
gtgcacgactatacactcaccgacgagatcgagtatatcaagccgaagaagcgggtgtat
tga

DBGET integrated database retrieval system