KEGG   Sphingomonas sp. WHSC-8: TS85_22735Help
Entry
TS85_22735        CDS       T03848                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00630  Glyoxylate and dicarboxylate metabolism
sphi01100  Metabolic pathways
sphi01120  Microbial metabolism in diverse environments
sphi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sphi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TS85_22735
Enzymes [BR:sphi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TS85_22735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AJP74745
UniProt: A0A0C5L1I6
LinkDB All DBs
Position
complement(4968727..4970001)
Genome map
AA seq 424 aa AA seqDB search
MPGSDRVTATYHIETAFPLEQAAATMAGEQSTGTFVRVPGETDALREAHAARVEELVELG
DVAAPSLPGSGLPKGGGDGRRRTARVTLSWPLANFGPSLPNVLATIAGNLSELKAFSGLK
LVDITLPPAFLDRYQGPQFGVAGTRRLAGVYDRPILGTIIKPSVGLSPEATAEQVRVLVE
AGVDFIKDDELQADGPHCPFDARIAAVMRVIRDHADRTGKKVMYAANLTGDIDEMLWRHD
QVLAQGGTCIMASMNSIGLPAMRMLRAHAQLPIHGHRNGWGMLGRSPAIGMHYIAFQKLW
RLAGIDHSHVNGIDNKFCETNDSVIASARECLTPMFAPPHPGCEILPVFSSGQSVMQAAA
TYQALGTTDLMYAAGGGIMAHPGGPAAGVRALRLAWDAAVAGVPLADAAKDAPELRAAMQ
AFGG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcagcgatcgggtcaccgcgacctaccatatcgaaaccgcctttccgctcgaa
caggcggcggcgacgatggccggcgaacagtcgaccggcaccttcgtccgcgtgcccggt
gagaccgacgcattgcgcgaggcgcatgccgcgcgggtcgaggaactggtcgaactcggc
gatgtcgccgccccctcgctgcccggatcggggctgccaaaggggggtggcgacgggcgg
cggcgcaccgcgcgcgtcactttgtcctggccgctcgccaatttcgggccgtcgctgccc
aatgtgctggcgacgatcgcgggcaatttgtccgagctgaaggccttttcggggctcaag
ctcgtcgacatcacgctgcccccggcgtttctcgatcgctatcaggggccgcaattcggc
gtggcgggcacccgccggctggcgggtgtgtatgaccgcccgatcctcggcacaatcatc
aagcccagcgtcggcctgtctcccgaggcgaccgccgaacaggtccgcgtcctggtcgag
gcgggggtcgatttcatcaaggacgacgagcttcaggccgatggcccgcattgcccgttc
gacgcgcgcatcgcggcggtgatgcgggtgatccgcgaccatgccgaccgtaccggcaag
aaggtgatgtacgccgccaacctgaccggcgacatcgacgagatgctgtggcgccatgac
caggtgctggcacagggcggcacctgcatcatggcgagcatgaactcgatcggcctcccc
gcgatgcggatgctgcgcgcgcatgcccagctcccgatccacggccaccgcaatggctgg
ggcatgctcggtcgctcgccggcgatcggcatgcactatatcgcattccagaaattgtgg
cggctcgccgggatcgaccacagccatgtcaacggcatcgacaataaattctgcgaaacc
aacgacagcgtgatcgcgtcggcgcgcgaatgcctgaccccgatgttcgcgcccccgcat
cccggatgcgagatcctgccggtgttctcgtcggggcaatcggtgatgcaggccgcagcg
acctatcaggcgctcggcaccaccgacctgatgtacgcggcgggcggcgggatcatggcg
catccgggtggccccgcggcgggcgtgcgcgcgctgcggctcgcctgggatgccgccgtc
gcgggggtcccgcttgccgacgcggcgaaggacgcacccgaactgcgcgcggcgatgcag
gcgttcggcgggtga

DBGET integrated database retrieval system