KEGG   Sphingomonas sp. WHSC-8: TS85_22990Help
Entry
TS85_22990        CDS       T03848                                 

Gene name
chlL
Definition
(GenBank) protochlorophyllide oxidoreductase
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
sphi  Sphingomonas sp. WHSC-8
Pathway
sphi00860  Porphyrin and chlorophyll metabolism
sphi01100  Metabolic pathways
sphi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sphi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TS85_22990 (chlL)
Enzymes [BR:sphi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     TS85_22990 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_26 AAA_24 AAA_10 MipZ AAA_25 AAA_16 NB-ARC SRP54
Motif
Other DBs
NCBI-ProteinID: AJP74754
UniProt: A0A0C5LNB1
LinkDB All DBs
Position
complement(5028787..5029692)
Genome map
AA seq 301 aa AA seqDB search
MALMDPPTRARDRIGLDGEGSLQVALDPNDRIGNAKVFAVYGKGGIGKSTTSSNLSAAFS
LLGKRVLQIGCDPKHDSTFTLTKKLMPTVIDVLETVQFHAEELRPEDYMFEGYNGVMCVE
AGGPPAGTGCGGYVVGQTVKLLKQHHLLEETDVVLFDVLGDVVCGGFAAPLQHAERAVVV
ASNDFDSIFAMNRIVAAIKAKARNYDVRMAGVIANRSAATDEIDRFNAATGLKTLAHFPD
LDAIRRSRLKKCTLFEMEQTPEVAAACDEYKRLAATMWAGCDALDAEPMKDRDIFEFLGF
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatggatccccccacccgcgcgcgcgaccggatcggcctcgatggcgaaggc
agcctccaggtcgcgctcgatcccaacgaccggatcggcaatgcaaaggtgttcgccgtc
tatggcaagggcgggatcggcaaatcgaccacctcatcgaacctctccgccgccttctcg
ctgctcggcaagcgcgtgctccagatcggctgcgaccccaagcatgacagcaccttcacg
ctcaccaaaaagctgatgccgacggtgatcgacgtcctcgaaaccgtccagttccacgcc
gaggaactgcgccccgaggattatatgttcgagggctataacggcgtgatgtgcgtcgag
gcgggcggccccccggcgggcaccggctgcggcggctatgtcgtcggccagacggtcaag
ctcctcaagcagcatcatttgctcgaagagaccgatgtcgtgctgttcgacgtgctcggc
gacgtggtgtgcggcgggttcgccgcgccgctgcaacatgccgaacgcgcggtggtggtc
gcctccaacgacttcgacagcatcttcgcgatgaatcgcatcgtcgccgcgatcaaggcc
aaggccaggaactatgatgtgcggatggcgggggtgatcgccaaccgttcggcggcgacc
gacgagatcgaccgcttcaacgccgcgaccggcctcaagacacttgcgcacttccccgat
ctcgacgccatccgccgctcgcggctcaagaaatgcaccttgttcgagatggaacagacc
cccgaggtcgcggcggcatgcgacgagtataagcgcctggcggcaacgatgtgggcaggc
tgcgacgcactcgatgccgagccgatgaaggaccgcgacatcttcgaattcctggggttc
gaatga

DBGET integrated database retrieval system