KEGG   Sphingomonas sp. JJ-A5: BSL82_02545Help
Entry
BSL82_02545       CDS       T04967                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSL82_02545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphj02000]
    BSL82_02545
Enzymes [BR:sphj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BSL82_02545
Transporters [BR:sphj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSL82_02545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_22 AAA_29 AAA_30 AAA_23 AAA_33 AAA_16 Rad17 PRK AAA_18 AAA_28 cobW Mg_chelatase AAA_25 RNA_helicase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: API58324
UniProt: A0A1L3ZRR5
LinkDB All DBs
Position
complement(492102..492896)
Genome map
AA seq 264 aa AA seqDB search
MDAPAHRTAGGTSPLKMTARNVNVFYGDKQAIKDVSIDVDQDHVTAFIGPSGCGKSTFLR
TLNRMNDTVESARVEGDITLDGEDIYGSSMDVVQLRARVGMVFQKPNPFPKSIYENVAYG
PRIHGLASTKADLDRMVEKSLRRAGLWEEVKDRLLDSGTALSGGQQQRLCIARAIAVDPE
VILMDEPCSALDPIATAKIEELIHELRGRYAIVIVTHNMQQAARVSQKTAFFHLGNLVEY
GDTSEIFTNPRETRTKDYITGRYG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccccgcgcatcgcacggcgggtggtacgtccccgctgaagatgaccgcccgc
aacgtcaacgtcttctatggcgacaagcaggcgatcaaggatgtctcgatcgacgtcgat
caggaccatgtgaccgctttcatcggtccgtcgggatgtggcaagtccaccttcctgcgg
acgctgaaccggatgaacgacaccgttgaaagcgcgcgtgtcgaaggcgacatcacgctg
gacggcgaggatatctacgggtccagcatggacgtggtgcagcttcgcgcccgtgtgggc
atggtgttccagaagcccaacccgttcccgaagtcgatctatgagaacgtcgcctatggg
ccgcgcatccatggccttgcgtccaccaaggcggatctggaccgcatggtcgaaaagtcg
ctgcggcgcgccggtctgtgggaagaggtgaaggatcgcctgcttgacagcgggaccgcg
ctttcgggcggccagcagcagcgcctttgcatcgcccgcgccatcgcggtcgatcccgag
gtaatcctgatggacgagccatgctcggcgctggacccgatcgccaccgccaagatcgag
gaactgatccacgaattgcgcgggcgctatgcgatcgtgatcgtcacccacaatatgcag
caggctgcgcgcgtcagccagaagacggcgtttttccatctcggcaatctggtcgaatat
ggcgacacgtcggaaatcttcaccaacccgcgcgaaacccgtaccaaggattacatcacc
ggccgctacggctga

DBGET integrated database retrieval system