KEGG   Sphingomonas sp. JJ-A5: BSL82_05060Help
Entry
BSL82_05060       CDS       T04967                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sphj  Sphingomonas sp. JJ-A5
Pathway
sphj00473  D-Alanine metabolism
sphj01100  Metabolic pathways
sphj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSL82_05060
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSL82_05060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphj01011]
    BSL82_05060
Enzymes [BR:sphj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSL82_05060
Peptidoglycan biosynthesis and degradation proteins [BR:sphj01011]
 Precursor biosynthesis
  Racemase
   BSL82_05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: API58760
UniProt: A0A1L3ZT35
LinkDB All DBs
Position
complement(989590..990732)
Genome map
AA seq 380 aa AA seqDB search
MVRSICPATASRLIVDLDALSGNYASLSRKLAPAACGAVVKANAYGLGAVPVVEALQAAG
CRLFFTAHLAEALDLMSVVDPTCEIVILNGLDPDCEPVCAEHGFVPALNSMAQIERWRAL
AIAQGRRLPAALQVDSGMSRLGLTLDDAQALSATAIGDNIDLRLILTHLACADDPCREEN
RMQRARFEEINRLFPGIPASIANSGAAFLTPDFHLDIARCGIALYGVAPTLAQPGELRSV
VRLDARVIQIRDIEVGTGIGYGFDHVARCPMRIATVGIGYADGISRRFAQSGAAWYQKHR
LPLVGRISMDSLAIDISGLPDGLLREGGFVELIGPNQPLEAMADAVGTIPYEILTGLGRR
HERLYVQNHRSERQSAGAWS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttggtacgcagcatctgtccggccacggctagtcggttaatcgtcgatctcgacgcattg
agcggaaattatgcttccctgtcccgcaagctggcgcctgcggcgtgcggcgcggtcgtg
aaagccaacgcttatggtttgggagcggtgccagtcgttgaggcgctgcaggctgcaggc
tgcaggctgtttttcacggcgcatctggcggaggcactcgacctgatgtcggttgtcgat
ccgacatgcgagatcgtcatcctcaacggcctggatcctgattgcgagcctgtctgtgcc
gagcatggctttgtgcccgccctcaattcaatggcacaaattgagcgctggcgagccctt
gcgatcgctcagggccggcgcctcccggccgcactgcaggtggacagcgggatgtcgcgg
ctcggactgaccctcgacgacgcccaagcgctaagcgcgaccgcgatcggcgacaatatc
gatctccggctgatccttacccatcttgcctgtgcggatgatccatgccgcgaggaaaac
cggatgcaacgcgcgcgtttcgaggagatcaaccgcctgttcccggggatcccggcctcc
atcgcgaacagcggtgctgctttcctgacaccggacttccacctggacatcgcacggtgt
ggcatcgccctatacggggtggcgccaacattggcacagccgggcgaactgcgatcggtc
gtgcgcctcgacgcccgcgtcatccaaatccgcgacatcgaagtcggcacggggataggc
tacggcttcgaccatgttgcgcgctgtcccatgcggatcgcgaccgtcggcatcggatat
gccgacggcatctcgcgaaggttcgcacagagcggcgctgcctggtatcaaaagcaccgc
cttccgcttgtcggccgcatctcgatggacagtcttgccatcgacatttcgggtctgccg
gacggcctcctacgcgaaggaggattcgtcgagctgatcggcccgaaccaaccactggag
gccatggcggacgcggtaggaacgatcccctacgagatcctcacagggctcggtcgtcgg
cacgagcgtctctacgttcagaaccatcgttcggaacgccagagtgcgggagcatggtca
tga

DBGET integrated database retrieval system