KEGG   Sphingomonas sp. JJ-A5: BSL82_05585Help
Entry
BSL82_05585       CDS       T04967                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
sphj  Sphingomonas sp. JJ-A5
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSL82_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: API58844
UniProt: A0A1L3ZT85
LinkDB All DBs
Position
complement(1094808..1095557)
Genome map
AA seq 249 aa AA seqDB search
MLVDPWFYAIAVPAVILLGLSKGGFAGVGSISMPLIALVIPPVQAAAVVLPILIVQDVVG
VWAFRRTVDWRMLAVLMPGTVIGVGLGYLFATQVSVKGVLGMVGGLSVLFGVHRLWTEGR
GPPAATRGLPEWMGSLFGAASGFTSQIAHAGAPPFQMWVMPRKLSRDLLVGTTAVYFGAT
NWIKVPAYIALGQFTAANMLITATLIPVAILSTFAGVALVRRVSPDKFNRIIYVLMILVG
LKLCWDAAF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttgatccctggttctacgccatcgccgttccggccgttatcctgctcggcttg
tcaaagggcgggttcgccggcgtcggcagtatctcaatgccgctgatcgcgctggtgatc
ccgcctgtgcaggccgccgcagtcgtcctgcccatcctgatcgtgcaggacgtggtcggt
gtctgggcgttccggaggacggtggactggcggatgctcgccgtattgatgccgggcacc
gtcatcggcgtggggctgggctatctgttcgcgacgcaggtttcggtaaagggcgtgctc
ggcatggtgggcgggctctctgttctctttggcgttcatcgcctgtggacggaggggcgc
ggcccgcccgccgcgacgcgcggccttcctgaatggatgggaagcctctttggcgcggcg
tccggtttcaccagccagatcgcccatgcgggcgcgccgccgttccagatgtgggtgatg
ccgcgcaagctgtcgcgggacctgctggtcggcaccaccgccgtctatttcggcgcgacc
aactggatcaaggtgcctgcctatatcgcactcggccagttcaccgccgccaatatgctg
ataacggccacgctcattcccgttgccatcctctcgacctttgcgggcgtggctctggtg
cggcgcgtctctcccgacaagttcaaccgcatcatctatgttctgatgattctcgtcggc
ttgaagctgtgctgggacgcggccttctga

DBGET integrated database retrieval system