KEGG   Sphingomonas sp. JJ-A5: BSL82_08615Help
Entry
BSL82_08615       CDS       T04967                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sphj  Sphingomonas sp. JJ-A5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: API59365
UniProt: A0A1L3ZUR1
LinkDB All DBs
Position
complement(1646991..1648490)
Genome map
AA seq 499 aa AA seqDB search
MATGLHDGDQGFRLANPERLFIGGEWKNPVEGQGLDVISPVDGKVGARVAAGGPRDVEAA
VRAARNAFDNGPWPRMPIAERAAIVRRIGALLHERLAETAWATTLEMGAPLPMARAVAER
AAALFDDYAAIGESYPVEDLRRRTNGEYAIVVSEPAGVVAAIVPWNGPSLLAALKVAPAL
VAGCTVILKPAPETPLDSYILAECIEAAGVPAGVFNLVTADRETSDHLIRHRDVDKISFT
GSTAVGKHILRTAADRVARVSLELGGKSAAIVLDDADPELAVSRLAGEATMNTGQVCAAL
MRVIVPRAQVKMYSEMLAEAVSGMRVGNPFDEGTQIGPLAMERQLERVQGYIRKGREEGA
KLVCGGARPADLNSGFYIQPTVFADVSQSMTIAREEIFGPVTSVIAHDGLDDAVRIANDS
DYGLHGGVFTSDVDAAYAIARRMRTGNVGHNIRAIDWHMPFGGFKQSGLGREGGVEGFRN
FLEVKTVYVSTPPSKFANS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggggcttcatgacggggatcagggcttcaggctcgccaatccagagcggttg
ttcattggcggggaatggaaaaatcccgtcgaagggcaggggctggacgtaatttctccc
gttgacggcaaggtcggagcccgcgtagccgccggcggcccgcgggacgtggaagcggct
gtgcgtgcggcgcggaatgcctttgacaatggaccatggcctcggatgcccatcgccgaa
cgtgccgcgatcgtgcgccggatcggcgctttgctgcacgaacggcttgcggaaaccgct
tgggcgaccacgctggaaatgggcgcgccattgccgatggcgcgtgctgtggcggaacgt
gctgcggcgttgttcgacgattatgccgctatcggtgaatcctatcccgttgaagatcta
cgccgcaggaccaatggcgaatatgcaattgtagtcagcgaacccgccggggtcgtcgcg
gcgattgtgccctggaacgggccgagtctgctggcggccttgaaggttgcccccgcactg
gtggcgggctgcactgtcattttgaagccggcgcccgaaacgcccctggattcctatatc
ctggcggaatgcattgaggctgccggcgtccccgcgggcgtattcaatctggtaacggcc
gatcgcgagaccagcgatcatctgatccgtcaccgcgacgtggacaagatcagcttcacc
ggcagcaccgcggttggcaaacacatcctgcgcaccgcggcggatcgcgtggcaagggta
agcctggaactgggcggaaagtcggccgccatcgttctggacgacgccgatcccgagctt
gccgtcagccgtcttgccggtgaggcgacgatgaataccggacaggtctgtgcggcgctg
atgcgcgtgatcgttcccagggcgcaggtgaagatgtacagcgaaatgctggcggaggcg
gtttccggaatgagggtcggaaacccctttgacgaaggaacgcagattggtccgcttgcc
atggaacgtcagcttgaacgcgtccagggctatatcagaaaggggcgcgaggaaggcgca
aagctggtgtgcggcggggcgcgaccggctgacctcaacagcggcttttacatccagccc
acggtttttgcggacgtaagccagagcatgacgatcgcgcgggaggagattttcggaccc
gtgacgagcgtgatcgcgcatgacggcctggatgatgccgttcgtatcgcaaacgacagc
gattatgggctgcatggcggcgtcttcacaagcgatgtggacgcggcttatgcgattgcc
cgacggatgcgcaccggcaatgtcggccataacatccgggccattgattggcacatgccg
tttgggggattcaagcagtccggcctcggccgggaaggcggcgtggaaggcttccgcaat
tttcttgaagtcaagacggtctatgtttcaactccaccgtcaaaattcgcgaattcatga

DBGET integrated database retrieval system