KEGG   Sphingopyxis fribergensis: SKP52_14790Help
Entry
SKP52_14790       CDS       T03542                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00473  D-Alanine metabolism
sphk00550  Peptidoglycan biosynthesis
sphk01100  Metabolic pathways
sphk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SKP52_14790 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SKP52_14790 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SKP52_14790 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sphk01011]
    SKP52_14790 (ddl)
Enzymes [BR:sphk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SKP52_14790 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sphk01011]
 Precursor biosynthesis
  Amino acid ligase
   SKP52_14790 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AJA09840
UniProt: A0A0A7PIL4
LinkDB All DBs
Position
complement(3160117..3161043)
Genome map
AA seq 308 aa AA seqDB search
MSRGPWHVAVLMGGWSAEREVSLMSGNGVADALESRGHKVTRIDMDRDVALRLAEAKPDV
VFNALHGVPGEDGTVQGMLDLMGLKYTHSGLVTSVIAIDKELTKQALVPHGIPMPTGTMV
DSESLFTIDPLPRPYVLKPVNEGSSVGVAIVKDDSNYGNPIAREAVGPWQEFDRLLAEPF
IKGRELTVAVLGDTALAVTELRVKSGFYDYDAKYTDGLTEHVCPADVPDDVAQRMKDLAL
QSHRLLGCKGASRSDFRWDDEHGLAGIFLLEVNTQPGMTPLSLVPEQGRAVGMDYAELVE
RIVGEALS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggggtccgtggcatgtcgccgtcctgatgggcggctggtcggccgagcgcgaa
gtatcgctgatgagcggcaacggtgtcgccgatgcgctcgaatcgcgcggccacaaggtc
acgcgcatcgatatggaccgcgacgtcgcgctgcggctcgccgaggcgaaacccgatgtc
gtgttcaacgcgctccacggcgttccgggtgaagacggaaccgtgcagggcatgctcgac
ctgatgggtctcaaatatacgcacagcggcctcgtcacctcggtgatcgcgattgacaag
gaattgaccaagcaggcgctcgtgccgcatggaatccccatgccgacggggacgatggtc
gacagcgaaagcctctttacaatcgaccccttgccgcgcccctatgtgttgaaacccgtc
aacgaaggatcgtcggtcggggtcgcgatcgtcaaggacgacagcaattatggcaacccg
atcgcgcgcgaggccgtggggccgtggcaggaattcgaccgcttgctcgccgagcctttc
atcaaagggcgcgaacttaccgtcgcggtccttggcgacaccgcgctcgccgtcaccgaa
ctgcgcgtcaagtcgggcttctacgattatgatgccaaatataccgacggtctgaccgaa
catgtctgccccgccgacgtccccgatgacgtcgcgcagcggatgaaggatctggcgctg
caatcgcaccgcctgcttggctgcaagggcgcctcgcgctcggattttcgctgggacgac
gaacatggcctcgcgggtatcttcctgctcgaggtcaacacccagccgggcatgacgcca
ctcagcctcgtgcccgaacagggacgcgcggtgggcatggattatgccgaactggtcgaa
cgcatcgtgggggaagcgttatcatga

DBGET integrated database retrieval system