KEGG   Sphingopyxis fribergensis: SKP52_15910Help
Entry
SKP52_15910       CDS       T03542                                 

Definition
(GenBank) AP endonuclease, family 2 protein
Organism
sphk  Sphingopyxis fribergensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: AJA10058
UniProt: A0A0A7PLE5
LinkDB All DBs
Position
complement(3393515..3394558)
Genome map
AA seq 347 aa AA seqDB search
MKGPAVFLAQFMSDTAPFDTLPSAARWMADAGYVGVQIPTWDSRCIDLALAAESQDYCDE
LSGTCREAGVEITELSTHLQGQLVAVHPAYDVAFDAFAPEALRGKPAERQIWAVEQLHLA
AKASRRLGLNAHATFSGALAWPYIYPWPQRPAGLVEEAFGELAKRWRPILDAFEEQGVDL
AYEIHPGEDLHDGVSFERFLAGVGNHPRANILYDPSHYVLQALDYLQFIDIYHERIRMFH
VKDAELNPTGRSGVYGGFQDWVDRPGRFRSLGDGQVDFAGIFSKLTQYDYAGWAVLEWEC
CLKHPEDGAREGAPFIAAHMIRKADRAFDDFAGGSDPALNRKMLGLT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtccagcggttttcctcgcgcagttcatgagcgatacggcgccgttcgacact
ttgccctccgccgcgcgctggatggccgatgcgggctatgtcggcgtccagatcccgact
tgggacagccgctgcatcgatttggcgcttgcggccgaaagccaggattattgcgatgag
ctatcgggcacctgccgcgaggcgggggtcgagatcaccgagctgtcgacgcatttgcag
ggccagctggtcgcggtgcacccggcctatgatgtggcgttcgacgcgttcgcccccgaa
gcgctgcgcggcaaacccgccgagcgccagatatgggcggtcgagcaactccatcttgcg
gcgaaggcgagccggcggctggggctgaacgcgcatgcgaccttctcgggcgcgctggcc
tggccttatatctatccctggccgcagcgccccgcagggctggtcgaggaggcgttcggc
gaactcgcgaagcgctggcggccgatcctcgatgccttcgaggaacagggtgtcgatctt
gcctacgagattcatccgggcgaggatttgcatgatggtgtgagtttcgagcgtttcctc
gcgggcgttggcaaccacccgcgcgccaatatcctctatgaccccagccattatgtgctc
caggcgctcgactatctgcagttcatcgacatttatcatgagcggatccggatgttccac
gtcaaggacgcggagctcaatccgaccggccgctcgggggtctatggcggctttcaggac
tgggtcgaccgccccggccgcttccgctcgctcggcgacgggcaggtcgatttcgccgga
atcttctcgaagctgacgcaatatgactatgccggatgggcggtgctcgaatgggaatgc
tgcctgaagcatcccgaagacggcgcgcgcgagggcgcccctttcatcgccgcgcacatg
atccgcaaagccgaccgggcgttcgacgatttcgctggcggcagcgatcccgcgctcaac
cgcaaaatgctgggactgacctga

DBGET integrated database retrieval system