KEGG   Sphingopyxis fribergensis: SKP52_16215Help
Entry
SKP52_16215       CDS       T03542                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sphk  Sphingopyxis fribergensis
Pathway
sphk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sphk01100  Metabolic pathways
sphk01110  Biosynthesis of secondary metabolites
sphk01130  Biosynthesis of antibiotics
sphk01230  Biosynthesis of amino acids
Module
sphk_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sphk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SKP52_16215
Enzymes [BR:sphk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SKP52_16215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 AAA_18 AAA_22 CoaE AAA_17 dNK AAA_16 Cytidylate_kin AAA_5 AAA_28 TsaE RsgA_GTPase AAA APS_kinase DUF2497
Motif
Other DBs
NCBI-ProteinID: AJA10117
UniProt: A0A0A7PQ88
LinkDB All DBs
Position
3455287..3455847
Genome map
AA seq 186 aa AA seqDB search
MTAGPIPASIRERSIVLVGLMGSGKSTVGRRLAQRLGMRFADADDEIERAADTSISDIFE
RFGEAHFRDGERRVIARLLAGKPMVLATGGGAFINDETRALILRGSLCIWLDADIATLVE
RVGRRSHRPLLKNRDPGEVLRDLAAVRNPIYAEAHLRVSSASTPHDHTVRAILEALSKWE
DPQWKA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggggcccatccccgcgtcgatccgcgagcggtcgatcgtgctcgtcggtttg
atgggctcgggaaaatcgaccgtcggccgccgcctcgcgcagcggctcggcatgcggttc
gctgatgccgacgacgagatcgaacgcgccgccgacaccagcatttccgacattttcgag
cggttcggcgaggcgcatttccgcgacggcgaacgccgcgttatcgcccggcttctggcc
ggaaagccgatggtgctggcgaccggcggcggcgctttcatcaacgacgaaacgcgcgcg
ctgatcctgcggggcagcctttgcatctggctcgacgccgatatcgcgacgctcgtcgaa
cgcgtcggccgccgcagccaccgcccgctgctcaagaaccgcgaccccggcgaggtgctc
cgcgacctcgcggcagtccgcaatcccatctatgccgaggcgcatcttcgcgtcagttcg
gcaagcacgccgcacgaccacacggtgcgcgcgatcctggaggccctgtcaaagtgggaa
gatccgcaatggaaagcctga

DBGET integrated database retrieval system