KEGG   Sphingopyxis sp. LPB0140: LPB140_01310Help
Entry
LPB140_01310      CDS       T04602                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sphl  Sphingopyxis sp. LPB0140
Brite
KEGG Orthology (KO) [BR:sphl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphl02000]
    LPB140_01310
Transporters [BR:sphl02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LPB140_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_16 SMC_N AAA_30 AAA_22 AAA_29 SbcCD_C AAA_24 cobW AAA_33 T2SSE MMR_HSR1 ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: APG61696
UniProt: A0A1L3J982
LinkDB All DBs
Position
complement(264722..265684)
Genome map
AA seq 320 aa AA seqDB search
MVNAIEAKGIVKIFDGFRAVDGVDLIVPKGSIFGILGPNGAGKTTLLRTLLGIIDPDEGS
RKLFGASRPLTQSARVGYLPEERGLYQSMRAVDTIAFMGALRGLPLTTGRKRGRELLEEA
GLGYAADRQIRQLSKGMAQTVQLMGTIVHEPELIILDEPFSGLDALNQAKLEKMIRAQAE
RGVTVIFSTHVIAHAERLCERIAIIAGGKISFDGLVQEARDRLRPQVHLETANLDGPWRS
ALPQNCEPEGHWWHFTLPESGVEPLLTALVEGKAGIKSLSIERPGLHDAFVAIAGEAVAA
QMDEMVDETELQTLSAGAKL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgcaatagaggcaaaaggcatcgtcaaaatatttgatggctttcgtgcggtg
gacggtgttgacttaattgtaccaaagggcagcatttttggcatattgggaccaaatggc
gcgggtaaaaccacattattgcgcactttattggggattattgatcctgatgagggcagc
cgtaaattatttggcgcatcgcggccattaacccaatcagcacgggtgggatatttaccc
gaagaacgtggtctctatcaatccatgcgggcggtggacaccatcgcctttatgggcgcc
ttgcgtgggcttccattgaccacaggccgcaaaagggggcgcgaattattggaagaggcg
gggcttggctatgccgccgatcgacaaatccgccaattgtcaaagggcatggcccaaacg
gtgcagctaatgggcacgattgttcatgaaccggaattgattattttggatgaaccattt
tctggattggatgcgctgaatcaggcaaagttggaaaaaatgatccgtgcgcaggcagag
cgcggcgtgacggttattttttccacccatgtcatcgcccatgccgaaagattatgcgaa
cgtatcgccattattgcaggcggcaagattagctttgacggattggtgcaggaggcacgg
gacagattgcgcccgcaggtgcatttggaaacggcaaatttggatgggccatggcgcagt
gccttgccccaaaattgcgagccagaggggcattggtggcatttcaccctgcccgaaagc
ggggttgagccattattaactgcattggtggagggaaaggcaggcataaaaagcctgtcc
atcgaacggccgggattacatgatgcctttgttgccattgctggagaggcggtagccgcg
caaatggatgaaatggtggatgaaaccgaattacaaacattatcggcaggggcaaaatta
tga

DBGET integrated database retrieval system