KEGG   Sphingopyxis sp. LPB0140: LPB140_07345Help
Entry
LPB140_07345      CDS       T04602                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sphl  Sphingopyxis sp. LPB0140
Pathway
sphl00290  Valine, leucine and isoleucine biosynthesis
sphl00770  Pantothenate and CoA biosynthesis
sphl01100  Metabolic pathways
sphl01110  Biosynthesis of secondary metabolites
sphl01130  Biosynthesis of antibiotics
sphl01210  2-Oxocarboxylic acid metabolism
sphl01230  Biosynthesis of amino acids
Module
sphl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sphl_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sphl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    LPB140_07345
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LPB140_07345
Enzymes [BR:sphl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     LPB140_07345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: APG62632
UniProt: A0A1L3JBY2
LinkDB All DBs
Position
1548966..1550693
Genome map
AA seq 575 aa AA seqDB search
MNLGSDMEKSKLPSRHSSFGPERAPHRSYYYALGWSEEDIAKPFVGIASAGNDSAPCNST
LNAQADVAREGVIAAGGTPFRFNTITVTDGIAMGHQGMKSSLISREVIADSVELSVRGHC
YDALVTYAGCDKSLPGMMMAMLRLNVPSIFVYGGSILPGQYKGQDVTVVDVFEAVGQHAA
DNCPLKELIELEKVACPGHGACGGQFTANTMACVAEAIGLSLPNSNMAPAPYGSRAEIAT
KAGEQVMYLLENNIRPRDICTRKAFENAARVVAATGGSTNAALHLPAMANECGIDFNLFD
VAEIFKSTPYIADLKPGGKYVARDLYDAGGVYMVMKTLMDGGYLHGDCMTVTGKTLAENI
AEIQWNNDQKVVYDVKTPITKTGGVVGLKGSLAPEGAIVKVAGMARLQFTGPAMVFDCEE
DAFKAVEDREIKEGSVIVIRYEGPKGGPGMREMLSTTAALYGQGMGEKVALITDGRFSGA
TRGFCIGHVGPEASAGGPIALVEDGDIIAIDAEAGTIDLQVDAEILAQRKAKWQPRENDY
QSGALWRFAQNVGPAVDGAVTHPGAKKETHIYADI
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggggtcagatatggaaaaatctaaattacctagccgtcatagctcttttgga
cctgaaagagcgccgcatcgcagctattattatgcactgggatggagcgaggaggatatt
gcaaaaccctttgttggcattgcatcggcaggtaatgatagcgccccctgtaacagcaca
ttaaacgcgcaggctgatgtcgcgcgtgaaggcgtaattgcggctggtggtacgccattt
cggtttaacaccattacggttactgatggtattgccatggggcatcaggggatgaaatca
tccttgattagccgtgaagtaatcgcagattccgttgaattaagcgttagaggccattgt
tatgacgcgcttgtcacctatgcgggatgtgataaatccttgccgggcatgatgatggcg
atgttgcggttaaatgtgccgtcaatatttgtatatggtggttcaattttacctggtcaa
tataaagggcaggatgtcactgttgttgatgtgttcgaggcggttggccaacatgcggcg
gataattgcccattaaaagaattgattgagcttgaaaaagtagcatgtccaggacatggc
gcatgtggcggtcaatttactgcaaatacaatggcatgtgtggcagaggcaatcggcttg
tctctccccaatagcaatatggcgcctgcgccctatggcagcagggcagaaatagccaca
aaagcaggcgagcaggttatgtatttgcttgaaaataatattcgtccgcgtgatatttgc
acgcgaaaggcatttgaaaatgcggcgcgtgtggttgcggcaaccggcggctcaacaaat
gcggcgcttcatttacccgcaatggccaatgaatgtggtatagattttaatttatttgat
gtcgcagaaattttcaaatccacaccctatattgccgatttgaagcccggcggaaaatat
gttgcccgtgatttatatgatgcgggcggggtatatatggtgatgaaaacattgatggat
ggcggatatctgcatggcgattgcatgaccgtaacgggtaaaacattggccgaaaatatt
gctgaaattcaatggaataatgaccaaaaagttgtttatgacgtcaagacgcctatcacc
aaaactggcggtgttgtggggttaaaggggagccttgcccccgaaggtgcgattgtaaag
gttgccggcatggcccgtttgcaatttaccggtcctgccatggtgtttgattgtgaagaa
gatgcgtttaaggccgttgaggatcgcgaaattaaagaaggcagtgtgattgttattcgt
tatgaagggccaaagggcggtcctggcatgcgcgaaatgttgtccaccacggcggcacta
tatggtcagggcatgggcgagaaagttgccttaatcacggatggtcgtttttccggcgcg
acaagaggattttgtattggccatgtcgggccagaggcgtcggctggcggaccaatagct
ttggttgaggatggcgatattattgccattgatgcagaggcagggacaattgatttacaa
gttgatgcggaaattttggcgcagcgtaaggccaaatggcagccgcgtgaaaatgattat
caatccggtgcattatggcgctttgcccaaaatgtcgggcctgcggttgatggggcggtg
acgcatccgggcgccaaaaaagaaacacatatttatgcggatatttaa

DBGET integrated database retrieval system