KEGG   Sphingopyxis sp. LPB0140: LPB140_11265Help
Entry
LPB140_11265      CDS       T04602                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sphl  Sphingopyxis sp. LPB0140
Pathway
sphl00061  Fatty acid biosynthesis
sphl00780  Biotin metabolism
sphl01100  Metabolic pathways
sphl01130  Biosynthesis of antibiotics
sphl01212  Fatty acid metabolism
Module
sphl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sphl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LPB140_11265
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LPB140_11265
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LPB140_11265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sphl01004]
    LPB140_11265
Enzymes [BR:sphl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LPB140_11265
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LPB140_11265
Lipid biosynthesis proteins [BR:sphl01004]
 Fatty acid synthase
  Component type
   LPB140_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: APG63267
UniProt: A0A1L3JDP1
LinkDB All DBs
Position
complement(2373572..2374375)
Genome map
AA seq 267 aa AA seqDB search
MTGLMSGKKGIIMGLANEKSLAWGIAQKLREHGAELAFSYLGEALEKRVRPLAEKLGSDI
CIPCDAGDADSINACFAEIEAKWGKIDFVVHAIGFSDKNELRGGYIDTSLDNFLMTMNIS
AYSLVAISRAARPLLNEGGSILTLSYYGAEKVIPHYNVMGVAKAALETSVKYLANDLGKE
GIRVNAISAGPIKTLAASGIGDFRYILKWNELNSPLRRNVTIEDVGGAGLYMLSDLASGV
TGEIHHVDAGYNVIGMKQEDAPDIALS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactggattgatgagcggtaaaaaaggcatcatcatgggccttgccaatgagaaatcc
ttggcatggggcattgcccaaaaattacgcgaacatggagcggaattggcatttagttat
ttgggggaggcattggaaaaacgtgtccgtcccttggccgaaaaattgggcagtgacata
tgcatcccatgcgatgcgggcgatgcagacagcatcaatgcctgttttgcggaaatagag
gcaaaatggggcaaaattgattttgttgtccatgccattggcttttcagataaaaatgag
cttcgcggcggatatattgataccagcttggataattttttaatgaccatgaatatcagc
gcatattcattggtggcgatatcgcgtgcggcgcggccattattgaacgagggcggcagt
attttgacgctttcctattatggcgcggaaaaggttatcccgcattataatgtcatgggc
gtggccaaggccgcattggaaaccagtgtgaaatatctggccaatgatttgggtaaggaa
ggaataagagtgaacgccatttccgccggcccgattaaaacattggcggccagcggcatt
ggcgattttagatatattttgaaatggaatgagttaaattccccgcttcgccgtaatgtc
accattgaagatgtgggcggcgctggtttatatatgctgtccgatttggccagcggcgtg
accggcgaaattcaccatgttgatgcgggatataatgtcattggcatgaaacaagaagac
gcaccggacattgcgttaagttaa

DBGET integrated database retrieval system