KEGG   Sphingopyxis sp. LPB0140: LPB140_11950Help
Entry
LPB140_11950      CDS       T04602                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sphl  Sphingopyxis sp. LPB0140
Pathway
sphl00620  Pyruvate metabolism
sphl00680  Methane metabolism
sphl01100  Metabolic pathways
sphl01120  Microbial metabolism in diverse environments
sphl01200  Carbon metabolism
Module
sphl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sphl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB140_11950
  09102 Energy metabolism
   00680 Methane metabolism
    LPB140_11950
Enzymes [BR:sphl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LPB140_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APG63381
UniProt: A0A1L3JE06
LinkDB All DBs
Position
complement(2503495..2506221)
Genome map
AA seq 908 aa AA seqDB search
MTKNSNPPHDTASLNEDGRPQISQNPDIRYLGKMLGDVIRAYGGEKLYRQTEYIRSSSVD
RRRKGSSVEDVDHGLGALSLDDTLDFTRGFMLFSILANLAEDRQGVAKEKGASVAEALEI
LRANGVSEDEVNKTLGNSLIAPVLTAHPTEVRRKSIIDHKSRIAELMAMRDAGLAETPSG
DTIENAIFRQIALLWQTRPLRREKLRVTDEIDNARSSMEQVFLTALPKLYARWENDLGFR
PTSFLRLGSWIGGDRDGNPFVGADSLQYAISRNGASALRYYMDFIHHLGSELSISSEQTD
IPQEVLDLAENSGDNATSRADEPYRRALSGIYARISATYIDLVGESPPRPSTIKAPKYDA
PEDLRADLVIIASGLRQGGEGALASGGALGRMIRAVETFGFHLATLDLRQNSDVHEELVA
ELLNIAGVEKDYKSLDEDARVKLLLNELSNNRPLSDGWHEYSEKTSHELAIIRAAAHAHA
QFGPQCITTYVISQTQSVSDLLEVYLMLKEAGLYRVDSNGNASAGIMVVPLFETVGDLKN
APDTMTNFFAIEKMKHLAEVRGYQEVMIGYSDSNKDGGYLTSTWELYEASLALAPVFKDA
GIAMQLFHGRGGAVGRGGGSAFGAIQAQPHGTVQGRIRITEQGEVIAAKYGSVDNAVASL
ETMTSATMLASLQEIKISPADLEKYSAAMTTLSASAFHAYRDLVYNHDGFKDFFRQMTPI
AEISGLKIGSRPASRKTGGRIQDLRAIPWVFSWAQARVMLPGWYGVGQALDEFEDKALLK
DMAQNWPFFETILSNMEMVLAKSDMRIASHYSQLVEDKALSSELFGRINDGWHKSRDGLL
EATGQNWLLEKNQSLFNSIELRLPYIEPLNLLQVELMKRHRSGENDPKVRDGISLTINAI
ATALRNSG
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaatagcaatcctccccatgatacggcttctttgaacgaagatggccgtccc
caaatctctcaaaatccagatattcgttatctgggtaaaatgctgggcgatgttattcgc
gcctatggcggcgaaaaattatatcgccagactgaatatatccgttcatccagtgtggac
cgccgccgaaaggggtcaagcgtggaggatgttgaccacggccttggcgcattatcattg
gacgatacattggattttacccgtggtttcatgttattttccatcttggccaatttggcc
gaggatcgccaaggcgttgccaaggaaaaaggcgcgagcgtggcagaggcgctggaaata
ttgcgggccaatggggttagtgaagatgaagtaaataagacattgggcaatagtttaatc
gcgccagtgttaaccgcccacccaaccgaggtgcgccgtaaaagcattattgatcataaa
agccgcattgccgagttaatggcaatgcgcgatgccggccttgccgaaacacccagcggc
gatacgattgaaaatgcgattttccggcaaattgctttattatggcaaacaaggccgctg
cgccgtgaaaaattgcgggtcaccgatgaaattgacaatgcacgttcatcaatggaacag
gtgtttttaaccgcgctgcccaaattatatgcgcgttgggaaaatgatctgggttttcgc
ccgacatcatttttgcgccttggcagctggattggcggcgaccgtgatggcaaccccttt
gttggcgcggattcgctgcaatatgccatttcgcgcaatggggcatcggcgctgcgttat
tatatggatttcatccatcatttgggcagcgagctttccatttccagtgaacagaccgat
attccgcaagaggtattggatcttgctgaaaatagcggcgataatgcgaccagccgtgcg
gatgaaccatatagacgagcattgtcgggaatttatgcccgtatcagcgcgacctatatt
gatttagtaggcgaatccccgccgcgcccatcgaccataaaggcaccaaaatatgacgcg
ccggaggatttacgcgccgatttggtgattattgcatcgggcctgcgtcaggggggtgag
ggcgctcttgcctctggcggggcattgggccgtatgatccgtgcggtggaaacatttggt
ttccatttggccacgcttgaccttcgtcaaaatagcgacgtgcacgaagaattggtggcc
gagctgttaaatattgctggcgttgaaaaagattataaatcactggatgaggatgcgcgg
gttaagctgttattaaatgagcttagcaataatcgccccctatccgatgggtggcatgaa
tatagcgagaagaccagccatgagctggccattattcgcgccgccgcccatgcccatgcg
caatttggaccacaatgtattaccacctatgtgattagccagacgcaaagcgtttccgac
cttttggaagtatatttaatgctgaaagaggcggggctttaccgtgttgatagcaatggc
aacgcatcggcgggcatcatggttgtgcctttattcgaaacggtgggcgatttgaaaaat
gcgcccgacacaatgaccaatttctttgccattgagaaaatgaagcatttggccgaagtg
cgtggatatcaagaagtaatgattggatattcagattccaataaggatggcggctattta
acctccacttgggaattatatgaggccagccttgcccttgcccccgtatttaaggatgcg
ggcattgccatgcagttattccacgggcgcggcggcgcagttgggcgcggcggcggcagt
gcatttggcgcgatacaggcacagccgcatggcacggtgcaggggcgcatccgcattacc
gaacagggcgaggtgattgcagcaaaatatggcagcgttgataatgcagtggccagtttg
gaaaccatgacatcggccaccatgttggcgtcattacaggaaattaaaatatcgcctgcc
gaccttgaaaaatatagcgcggcgatgaccacattatcggccagcgcctttcacgcctat
cgcgatttagtatataatcatgatgggtttaaggattttttccgccaaatgaccccaatt
gccgaaatttcgggtttgaaaattggctcgcgtcccgccagccgcaaaaccggtggccgg
attcaggatttgcgcgccatcccatgggtatttagctgggcccaggcacgggtcatgttg
cctggttggtatggcgtgggacaggcgcttgatgaatttgaggataaggcattgttaaaa
gatatggcgcaaaattggcctttctttgaaacgattttatccaatatggaaatggtgttg
gccaaatctgatatgagaatcgccagccattatagccaattggtagaggataaggcgcta
tcgagcgaattatttggccgtattaatgatggatggcataaatcgcgcgatggtttgttg
gaggcaacagggcaaaattggttgcttgagaaaaatcaatctttgttcaactcaattgaa
ctgcgtctgccctatattgaaccgttaaacctgttacaggtggaattgatgaaacgccac
cgcagcggggaaaatgatcccaaggtgcgcgacggcatttccctaaccattaacgccatt
gccaccgcattaaggaatagcgggtaa

DBGET integrated database retrieval system