KEGG   Sphingomonas sp. MM-1: G432_00930Help
Entry
G432_00930        CDS       T02498                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sphm  Sphingomonas sp. MM-1
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sphm01002]
    G432_00930
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphm04147]
    G432_00930
   04090 CD molecules [BR:sphm04090]
    G432_00930
Enzymes [BR:sphm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     G432_00930
Peptidases [BR:sphm01002]
 Metallo Peptidases
  Family M2
   G432_00930
Exosome [BR:sphm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G432_00930
CD molecules [BR:sphm04090]
 Proteins
  G432_00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AGH47914
UniProt: M4S0C6
LinkDB All DBs
Position
187918..189744
Genome map
AA seq 608 aa AA seqDB search
MKIPFRAAVSAVALGALAVSAAAFAAKDAAPTAADADRFVAAAEKELFDLSIPTAQVAWV
NATYITDDTDALNTLFGAKNTEASVRLAKEAARYDKVAGFSFDTRRKLDILRQGIVLPAP
ATEGAATELNALSTRMSSTYGKGRGTLAGKEINGSDIEEKMGTVRNPDQLKEMWASWHDN
VGKPMKADYARMVEIANQGAKELGYKDLGAMWRSNYDMSPDEFARLTDKLWLQVKPLYDQ
LHCYTRTKLNEKYGDGVQPRTGPIRADLLGNMWAQEWGNIYDVVAPAGAGDLGYDTTDLL
KAKGYDALKMVKGGENFFSSLGFAPLPDSFWQHSQFTKPADREVICHASAWDVDNKDDLR
IKMCIKVNGDDFTTIHHELGHNYYQRAYNKQPYLYLNGANDGFHEAIGDAIALSITPDYL
VRIGLLDPAKVPPADKDIGLLLRQAMDKVAFLPFGLLVDKWRWGVFDGSIAPQDYNKAWT
ALRLQYQGITPPVERGADAFDPGAKYHVPASTPYTRYFLARILQFQFYKAACDQAGWKGP
LHRCSFYGNKEVGANLNKMLEMGMSKPWPDALQAFTGSREMDGTAMIAYFKPLMTWLEQQ
NKGKTCGW
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcccgttccgcgccgccgtttcggccgtggcgctcggcgcactcgccgtttcc
gccgccgccttcgccgccaaggatgccgcgcccaccgccgccgatgccgatcgcttcgtg
gcggcggccgaaaaggagctgttcgatctttccatcccgaccgcgcaggtcgcctgggtc
aacgccacctacatcaccgacgataccgatgccctgaacaccctgttcggcgccaagaat
accgaagcctccgtgcgcctcgccaaggaggccgcccgctacgacaaggtcgcgggcttt
tccttcgatacccgccgtaagctcgatatcctgcgccagggcatcgtcctgcccgcgccc
gcgaccgagggggccgcgaccgaattgaacgcgctgtccacgcggatgagctccacctac
ggcaagggccgcggcacgctggccggtaaggagatcaacggctccgatatcgaggagaag
atgggcacagtccgcaacccggaccagctcaaggaaatgtgggcgagctggcacgacaat
gtcggcaagccgatgaaggccgattatgcccgcatggtggaaatcgccaatcagggcgcg
aaggagctgggctacaaggatctcggcgccatgtggcgctccaactacgatatgtcgccg
gatgagttcgccaggctgacggacaagctctggctgcaggtgaagccgctctacgatcag
ctccactgctacacccgcaccaagctgaacgagaaatatggcgatggcgtccagcccagg
accggcccgatccgcgccgatctgctcggcaacatgtgggcgcaggaatggggcaacatc
tatgacgtcgtcgccccggccggcgccggcgacctcggctatgacacgaccgatctgctg
aaggccaagggctatgacgcactgaaaatggtgaagggcggcgagaatttcttctcctcg
ctcggcttcgcgccgctgcccgacagcttctggcagcactcccagttcaccaagcccgcc
gatcgcgaggtgatctgccacgcgtccgcctgggacgtggacaataaggacgatctgcgg
atcaagatgtgcatcaaggtgaatggcgacgatttcaccaccatccaccacgagctgggc
cataattattaccagcgcgcctataacaagcagccctatctctacctgaacggcgcgaac
gacggcttccacgaggcgatcggcgatgcgatcgcactatcgatcacgcccgactatctc
gttcggatcgggctgctcgatccggcgaaggtgccgccggcggacaaggatattggcctg
ttgctgcggcaggcgatggacaaggtcgctttcctgcccttcggcctgctggtcgataaa
tggcgctggggcgtgttcgacgggtcgatcgcgccgcaggattacaacaaggcgtggacg
gcgctccgcctgcaatatcagggcatcaccccgcccgtggagcgtggggccgacgccttc
gatcccggcgccaaatatcatgtgcccgccagcacgccctacacccgctatttcctggcg
cgcatcctccagttccagttctacaaggccgcgtgcgaccaggccggctggaaggggccg
ctccaccgctgctccttctacggcaacaaggaagtcggcgcgaacctgaacaagatgctg
gagatgggcatgtcgaagccctggccggacgcgctgcaagccttcaccggcagccgcgag
atggatggcacggcgatgatcgcctatttcaagccgctgatgacgtggctggaacagcag
aataagggcaagacctgcggctggtga

DBGET integrated database retrieval system