KEGG   Sphingomonas sp. MM-1: G432_08190Help
Entry
G432_08190        CDS       T02498                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00010  Glycolysis / Gluconeogenesis
sphm00020  Citrate cycle (TCA cycle)
sphm00620  Pyruvate metabolism
sphm01100  Metabolic pathways
sphm01110  Biosynthesis of secondary metabolites
sphm01120  Microbial metabolism in diverse environments
sphm01130  Biosynthesis of antibiotics
sphm01200  Carbon metabolism
Module
sphm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G432_08190
   00020 Citrate cycle (TCA cycle)
    G432_08190
   00620 Pyruvate metabolism
    G432_08190
Enzymes [BR:sphm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     G432_08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N IER
Motif
Other DBs
NCBI-ProteinID: AGH49363
UniProt: M4S361
LinkDB All DBs
Position
complement(1691968..1693263)
Genome map
AA seq 431 aa AA seqDB search
MPIELKMPALSPTMEEGTLAKWLVKEGDTVKSGDLLAEIETDKATMEFEAVDEGTIAKIV
IPEGTDGVKVGEVIALIAGEGEDASAAASSAPAPKAEKPAEAPAPKAEPATAKAEAPKAD
APRPAAQPAASGDRVKASPLARRIAQAQGIDLAAVTGSGPHGRIVKADVEGVKPGAAAPA
AAAGAPAAQPAPAPAPAAAPAGIPAETIKLSNMRKTIAKRLTESKQTVPHYYLTIDCNLD
ALLKLRGELNAGLEGRGVKLSVNDLLIKALGVALAEVPDANVQFAGDNLVKFQRSDISMA
VAIPGGLITPVITDVVNKPLSRIATEAKDLAARAREGKLAPEEYQGGTASISNLGMFGIK
QFDAVINPPQGMILAVGAGEKRPYVVNDALAIATVMTATGSFDHRAIDGAVGAELMAAFK
RLVEKPLGMLA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaactcaaaatgcccgccctctcgccgacgatggaggaggggacgttggcg
aaatggctggtgaaggaaggcgatacggtgaagtccggcgatctcctggccgagatcgag
accgacaaggcgacgatggagttcgaggcggtcgatgaaggcacgatcgcgaagatcgtc
atccccgagggcaccgatggcgtgaaggtgggcgaggtgatcgcgctgatcgccggcgag
ggcgaggatgcctccgccgccgcgtcctccgcgcccgcgcccaaggcggaaaagccggcc
gaagcccccgcgccgaaggccgaacccgcgaccgccaaggccgaagcccccaaggcggac
gcgccccgtcccgccgcccagccggccgcatcgggcgatcgcgtgaaggcgagcccgctc
gcccgccgcatcgcccaggcccagggcatcgatcttgccgccgtcaccggatcggggccg
cacggccgcatcgtcaaggcggacgtggaaggcgttaagccgggcgcggccgccccggcc
gctgccgccggtgcgcccgctgcccagcccgcgcccgcgcccgcgcctgccgccgctccg
gccggcatcccggccgagacgatcaagctttccaacatgcgcaagacgatcgccaagcgg
ctcaccgagtcgaagcagacggtgccgcattattatctgacgatcgactgcaacctcgat
gcgctgctcaagctgcggggcgagctcaacgccgggctggagggccggggcgtcaagctt
tcggtcaacgatctcctcatcaaggcgctcggcgtggcgctggccgaggtgccggatgcg
aacgtccagttcgccggcgacaaccttgtcaaattccagcggtcggacatttcgatggcg
gtcgccatccccggcggcctcatcaccccggtgatcacggacgtcgtcaacaagccgctg
tcgcgcatcgccaccgaggcgaaggatcttgccgcccgtgcccgcgaaggcaagctcgcg
cccgaggaatatcagggcggcaccgcctccatctccaacctcggcatgttcggcatcaag
cagttcgacgccgtcatcaatccgccgcagggcatgatcctcgcggtcggcgcgggcgag
aagcggccctatgtcgtcaatgacgcgctggccatcgccacggtgatgacggcgaccggc
agcttcgatcaccgcgccatcgacggcgccgtcggcgccgagctgatggcggcgttcaag
cgcctcgtcgaaaagccgctgggcatgctggcttga

DBGET integrated database retrieval system